DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and Lnx1

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001101828.1 Gene:Lnx1 / 360926 RGDID:1308159 Length:728 Species:Rattus norvegicus


Alignment Length:103 Identity:28/103 - (27%)
Similarity:51/103 - (49%) Gaps:8/103 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GIGDTDGYPAFDVDSDAYATKDD--SRWGFLITGGA---EFHMPLTVFQVTPNGLADKAG-IRLG 84
            |...|...||........:.:.|  ...|..:.|||   |:.:|:.|..|.|.|:..:.| |:.|
  Rat   492 GERSTSSKPAATCHEKVVSVQKDPNESLGMTVGGGASHREWDLPIYVISVEPGGVISRDGRIKTG 556

  Fly    85 DIILEINEEDASQLTLSQAHEKINSTPKKIHFLLRNME 122
            ||:|.:|..:.::::.::|...:.|||..:  :|:.:|
  Rat   557 DILLNVNGIELTEVSRTEAVAILKSTPSSV--VLKALE 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 22/79 (28%)
Lnx1NP_001101828.1 RING 45..81 CDD:214546
DegQ <260..364 CDD:223343
PDZ_signaling 276..360 CDD:238492
PDZ_signaling 384..464 CDD:238492
PDZ_signaling 506..589 CDD:238492 22/84 (26%)
PDZ_signaling 637..721 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.