DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and pdzk1

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001122142.2 Gene:pdzk1 / 337325 ZFINID:ZDB-GENE-031222-1 Length:553 Species:Danio rerio


Alignment Length:440 Identity:87/440 - (19%)
Similarity:134/440 - (30%) Gaps:178/440 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 YATKDDSRWGFLI--TGGAEFHMPLTVFQVTPNGLADKAGIRLGDIILEINEEDASQLTLSQAHE 105
            |..|..|.:||.:  |.||.   .:.:..|...|:||:||::|||.::|||.|:...|...|..:
Zfish   129 YLQKSSSGFGFSLKSTKGAH---GIFMVDVVSGGVADQAGVKLGDRLVEINSENVEHLVHDQIVQ 190

  Fly   106 KINSTPKKIHFLLRNMEEDD--PMGQFEAGEEKSIVMRVP-KPLPPPSGRIRASSIEMRLLEMQR 167
            |:.:...::..||.:.|.|.  .....:.|...:.|..:| ||               |:.:|.:
Zfish   191 KVKAASDRLMLLLVDEEADRYFKSKNIQPGVSHATVKHLPHKP---------------RIADMIK 240

  Fly   168 KLSAIAEIPKILCSTLATVSQNFGRMSESE-------VDEDDVGEEEAYVQRKFSYDEDALDFEL 225
            :                  :..:|.|.:.:       :.|.|.|..                   
Zfish   241 R------------------ADGYGFMLKEDPKRKGHCIGEIDKGSP------------------- 268

  Fly   226 RNGEQAGDTDSDEEDLVLVREEDAEDV-------DVPKGAKQSKLLKDVTPESDY---------- 273
              .|:||..|.|.  |..|..||.|:.       .:.:|.|...|:.|...:..|          
Zfish   269 --AERAGMKDMDR--LAAVNGEDIENCKHEQVVEKICQGNKCCLLVLDAETDKIYKLGGVSPLLY 329

  Fly   274 -----ASEANYPANEASDDTESDDEDEPGSTVYFMKLPAAAAEDTYSSTEDEDDSDFLNTTYTWN 333
                 .|...||.|||                  :.:||.||                       
Zfish   330 WEEMRGSLPGYPDNEA------------------VAIPAVAA----------------------- 353

  Fly   334 LRNVPKLRINDAEAEGELTLGHQAREVPQQEQPQEKQPCLEPEPPKVRPATPTPKAPPQESAEGQ 398
                                     .||.........|...|.|    .|||||.....|.|:..
Zfish   354 -------------------------AVPAAVVAATPAPAATPAP----AATPTPVPAAAEPADVD 389

  Fly   399 TQKLLFRLDKLERSWPWADREKIIYKQSTCHLVPRKPLGLVGQRMQLLLK 448
            .:..|.||::....:.:             ||  ....|:.||.:|.::|
Zfish   390 HKPKLCRLERTSAGFGF-------------HL--NGIQGVPGQHIQEVVK 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 24/75 (32%)
pdzk1NP_001122142.2 PDZ_signaling 6..86 CDD:238492
PDZ_signaling 126..204 CDD:238492 25/77 (32%)
PDZ 232..311 CDD:214570 22/134 (16%)
PDZ_signaling 392..471 CDD:238492 10/48 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.