DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and CG43707

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001260005.1 Gene:CG43707 / 33601 FlyBaseID:FBgn0263846 Length:2021 Species:Drosophila melanogaster


Alignment Length:422 Identity:90/422 - (21%)
Similarity:147/422 - (34%) Gaps:158/422 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 EEDASQLTLSQA--HEKINSTPKKIHFLLRNME-------------------------------- 122
            |..:|::.:.||  |.:::..|:.|....|..:                                
  Fly   595 ESYSSEVCMEQAAQHRRMSMLPQMIDSPFRRDDLRRQSMPVYGQTEKLIDGFGPRSSFRRRDKVS 659

  Fly   123 --EDDPMGQFEAGEEKSIVMRV-PKPLPPPSGRIR-------ASSIEMRLLEMQRKLSAIA-EIP 176
              .|:|....|..:|:.|.:.. |...|.||.:::       .:.|.||.::.||...|.| .:|
  Fly   660 CFPDEPPAVQEVRDEQEIFIDFKPHISPKPSPKLQLKHRKQHKAEIAMRKMQQQRMAQAAALTLP 724

  Fly   177 KILCSTL-ATVSQNFGRMSESEVDEDDVGEEEAYVQRKFSYDEDALDFELRNGEQAGDTD--SDE 238
            |.....: ..|.:.....|:.|.|||:|.|.|         :||..: |:.:.||..:||  .||
  Fly   725 KPKSQPVEVEVRKVELEPSDEEEDEDEVSEPE---------EEDDGE-EIDDDEQKLETDLQEDE 779

  Fly   239 EDLV---------LVREEDAEDVDVPKGAKQSKLLK-DVTPESDYASEAN--------------- 278
            |.|.         :|...||||:.    .|:|:..| .|:.:.||.::|:               
  Fly   780 EPLYENITPCGCRVVPTSDAEDIQ----DKRSQFRKRSVSLDDDYEAKASETPTPTGLRLPSTPA 840

  Fly   279 -------------YPANE--ASDDTESDDE---DEPGSTVYFMKLPAA---AAEDTYS------- 315
                         ||:::  |:|:|....:   :|...||    |.|.   .::.:||       
  Fly   841 SPCRDELLANVSTYPSSDSLANDNTRDHSDGIWNESQVTV----LTAEQRDISDGSYSSNLLLTP 901

  Fly   316 --------------STEDEDDSDFLNTTYTWNLRNVPKLRINDAEAEGELTLGHQAREVPQQEQP 366
                          |:.|.|..||...:.|:.|:.:||:               .....|...:|
  Fly   902 SSKRKNLLLQHQQRSSVDTDALDFEEQSPTYGLQTLPKI---------------IKTPTPTTSRP 951

  Fly   367 QEKQPCLEPEPPKVRPAT----------PTPK 388
            ...||.:.|....|.|:|          |.||
  Fly   952 TSTQPMMPPPAIAVTPSTNQILDSCISSPLPK 983

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 7/28 (25%)
CG43707NP_001260005.1 PHA03369 <987..1394 CDD:223061
PDZ_signaling 1702..1775 CDD:238492
PH 1792..1894 CDD:278594
PH-like 1792..1893 CDD:302622
PH-like 1911..2011 CDD:302622
PH 1921..2014 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.