DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and CG5921

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_727061.2 Gene:CG5921 / 31538 FlyBaseID:FBgn0029835 Length:886 Species:Drosophila melanogaster


Alignment Length:251 Identity:58/251 - (23%)
Similarity:89/251 - (35%) Gaps:65/251 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SRWGFLITGGAEFHMPLTVFQVTPNGLADKAGIRLGDIILEINE---EDASQ---LTLSQAHEKI 107
            |.:||.:.||.|......|..|...|.|...|:|:||.||.||.   :||..   :.|....:::
  Fly    83 STYGFTVRGGREHGTGFFVSHVEHGGEAHLKGLRIGDQILRINGFRLDDAVHKEFIQLVAGQDRV 147

  Fly   108 NSTPKKIHFL-LRNMEEDDPMGQFEAGEEKSIVMRVPKPLPPPSGRIRASSIEMRLLEMQRKLSA 171
            ....:.:..| :|::.|:            .:...|.| ||..||....||.:.......|.:|.
  Fly   148 TLKVRGVGMLPVRDLPEE------------RLSWSVVK-LPSVSGTPSESSFKGERRGASRDISV 199

  Fly   172 IAEI-PKI-----LCS---------TLATVSQNFGR----------MSESEVDEDDVGEEEAYVQ 211
            :..: |:.     :|.         ...|..::..|          :|.:.:|..||...||...
  Fly   200 VLHVAPRTKLGLGICKGPEWKPGIFVQFTKDRSVAREAGLRPGDQILSVNSIDFSDVLFSEAVAV 264

  Fly   212 RKFSYDED-----ALDFELRNGEQAGD---------------TDSDEEDLVLVREE 247
            .|.|...|     |...:|..||.:|.               .|:..:.|..||||
  Fly   265 MKSSSKLDMVVRTAAGCDLFPGESSGYNSSASSVTGDQSPCWADAKSKRLTAVREE 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 22/76 (29%)
CG5921NP_727061.2 PDZ_signaling 82..152 CDD:238492 21/68 (31%)
PDZ_signaling 197..276 CDD:238492 14/78 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.