DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and Ush1c

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_006229284.1 Gene:Ush1c / 308596 RGDID:1303329 Length:910 Species:Rattus norvegicus


Alignment Length:365 Identity:83/365 - (22%)
Similarity:128/365 - (35%) Gaps:91/365 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GFLITGGAEFHMPLTVFQVTPNGLADKAGIRLGDIILEINEEDASQLTLSQAHEKINSTPKKIHF 116
            |..|:.|......:.|..|.|..|:.:.|:..||.|:|:|..|.:.|...:|...:.|:......
  Rat   223 GCSISSGPIQKPGIFVSNVKPGSLSAEVGLETGDQIVEVNGIDFTNLDHKEAVNVLKSSRSLTIS 287

  Fly   117 LLRNMEEDDPMGQFEAGEEKSIVMRVPKPLPPPSGRIRASSIEMRLLEMQRKLSAIAEIPKILCS 181
            ::             ||..:.:.|...:.|.    ..|...::.:.|.||::|:  .|..|||  
  Rat   288 IV-------------AGAGRELFMTDRERLE----EARQHELQRQELLMQKRLA--MESNKIL-- 331

  Fly   182 TLATVSQNFGRMSESEVDEDDVGEEEAYVQRKFSYDEDALDFELRNGEQAGDTDSDEEDLVLVRE 246
               ...|...|....|:.:....|.|.|.:......|:...|:.:..|..|    .:|.|:|.:.
  Rat   332 ---QEQQEMERQRRKEIAQKAAEENERYRKEMEQISEEEEKFKKQWEEDWG----SKEQLILPKT 389

  Fly   247 EDAEDVDVP---------------------KGAKQSKLLKDVTPESDYASEANYPANEASDDTES 290
            ..||...||                     |.||:.|..|       |.|..:...|:...:.|.
  Rat   390 ITAEVHPVPLRKPKSFGWFYRYDGKFPTIRKKAKEKKKAK-------YDSLQDLRKNKKELEFEQ 447

  Fly   291 ---DDEDEPGSTVYFMKLPAAAAEDTYSSTEDEDDSDFLNTTYTWNLRNVPKL------RINDAE 346
               .:::|.......:|:...|.|  .|.||.||..:...|.| |    |.:|      :|:.||
  Rat   448 KLYKEKEEMLEKEKQLKINRLAQE--VSETEREDLEESEKTQY-W----VERLCQTRLQQISSAE 505

  Fly   347 AE-GELTLGHQAREVPQQEQPQEKQPCLEPEPPKVRPATP 385
            .| .|:|.|.                  .|.||.|.|..|
  Rat   506 NEITEMTTGP------------------PPPPPSVSPLVP 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 17/66 (26%)
Ush1cXP_006229284.1 harmonin_N 2..80 CDD:259819
PDZ_signaling 85..165 CDD:238492
PDZ_signaling 209..289 CDD:238492 17/65 (26%)
Cgr1 <316..>358 CDD:281823 14/48 (29%)
PDZ_signaling 751..838 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.