DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and Pdlim4

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_062290.2 Gene:Pdlim4 / 30794 MGIID:1353470 Length:330 Species:Mus musculus


Alignment Length:262 Identity:60/262 - (22%)
Similarity:97/262 - (37%) Gaps:55/262 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SRWGFLITGGAEFHMPLTVFQVTPNGLADKAGIRLGDIILEINEEDASQLTLSQAHEKINSTPKK 113
            |.|||.:.||.:|..|||:.:|.....|..|.:..||:|..||.|....:|..:|..:|    |.
Mouse    11 SPWGFRLVGGRDFSAPLTISRVHAGSKAALAALCPGDLIQAINGESTELMTHLEAQNRI----KG 71

  Fly   114 IH-FLLRNMEEDDPMGQFEAGEEKSIVMRV---PKPLPPPSGRIRASSIEMRLLEMQRKLSAIAE 174
            .| .|..::...:......|.::|:...|:   |:.........|.||:....||..|       
Mouse    72 CHDHLTLSVSRPENKNWPSAPDDKAQAHRIHIDPESQDCSPATSRRSSVSGISLEDNR------- 129

  Fly   175 IPKILCSTLATVSQNFGRMSESEVDEDDVGEEEAYVQRKFSYDEDALDFELRNGEQAGDTDSDEE 239
                     :.:...:|:.....|..:.            |.:|..|..::.....:..|.:|..
Mouse   130 ---------SGLGSPYGQPPRLPVPHNG------------SSNEATLPAQMSALHVSPPTSADTA 173

  Fly   240 DLVLVREEDAEDVDVPKGAKQSKLLKDVTPESDYASEANYPAN--------EASDDTESDDEDEP 296
             .||.|..|.. ||:  |::..::|::  |....|||.....:        ||     .:..|.|
Mouse   174 -RVLPRNRDCR-VDL--GSEVYRMLRE--PAEPTASEPKQSGSFRYLQGMLEA-----GEGGDRP 227

  Fly   297 GS 298
            ||
Mouse   228 GS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 25/70 (36%)
Pdlim4NP_062290.2 PDZ_signaling 2..80 CDD:238492 25/72 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..153 10/76 (13%)
DUF4749 150..226 CDD:292558 18/86 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..242 6/16 (38%)
LIM_RIL 255..307 CDD:188835
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.