DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and Pdzd11

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_038955522.1 Gene:Pdzd11 / 302422 RGDID:1560007 Length:145 Species:Rattus norvegicus


Alignment Length:73 Identity:24/73 - (32%)
Similarity:40/73 - (54%) Gaps:6/73 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GFLITGGAEFHMPLTVFQVTPNGLADKAGIRLGDIILEINEED-----ASQLTLSQAHEKINSTP 111
            ||.|.||....:.:.:.:|.|:..|.:||::.||.:|.:|:.|     .|:|.:.||.| |..|.
  Rat    59 GFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKLCVFQAVE-ILKTA 122

  Fly   112 KKIHFLLR 119
            ::|...:|
  Rat   123 REISMRVR 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 23/71 (32%)
Pdzd11XP_038955522.1 PDZ_signaling 45..130 CDD:238492 23/71 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.