powered by:
Protein Alignment CG42319 and Pdzd11
DIOPT Version :9
Sequence 1: | NP_001137648.1 |
Gene: | CG42319 / 36473 |
FlyBaseID: | FBgn0259219 |
Length: | 452 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_038955522.1 |
Gene: | Pdzd11 / 302422 |
RGDID: | 1560007 |
Length: | 145 |
Species: | Rattus norvegicus |
Alignment Length: | 73 |
Identity: | 24/73 - (32%) |
Similarity: | 40/73 - (54%) |
Gaps: | 6/73 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 GFLITGGAEFHMPLTVFQVTPNGLADKAGIRLGDIILEINEED-----ASQLTLSQAHEKINSTP 111
||.|.||....:.:.:.:|.|:..|.:||::.||.:|.:|:.| .|:|.:.||.| |..|.
Rat 59 GFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKLCVFQAVE-ILKTA 122
Fly 112 KKIHFLLR 119
::|...:|
Rat 123 REISMRVR 130
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3528 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.