DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and PRICKLE4

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_037529.3 Gene:PRICKLE4 / 29964 HGNCID:16805 Length:384 Species:Homo sapiens


Alignment Length:116 Identity:27/116 - (23%)
Similarity:43/116 - (37%) Gaps:21/116 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 AAAAEDTYSSTEDEDDSDFLNTTYTWNLRNVPKLRINDAEAEGELTLGHQAREVPQQEQPQEKQP 371
            |...|.....||..|.:...:.|.:..|          ..|.|..:|..| |.:|.....||.:|
Human   260 AFLGETGLDRTEGRDQTSVNSATLSRTL----------LAAAGGSSLQTQ-RGLPGSSPQQENRP 313

  Fly   372 CLEPEPPK---------VRPATPTPKAPPQESAEGQTQKLLFRLDKLERSW 413
            ..:.|.||         :|....||.:....|::.:.:. .|..::|.:||
Human   314 GDKAEAPKGQEQCRLETIRDPKDTPFSTCSSSSDSEPEG-FFLGERLPQSW 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492
PRICKLE4NP_037529.3 PET_OEBT 1..116 CDD:193603
LIM1_Testin_like 124..181 CDD:188726
LIM2_Testin_like 187..242 CDD:188727
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.