DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and PRICKLE4

DIOPT Version :10

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_037529.3 Gene:PRICKLE4 / 29964 HGNCID:16805 Length:384 Species:Homo sapiens


Alignment Length:116 Identity:27/116 - (23%)
Similarity:43/116 - (37%) Gaps:21/116 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 AAAAEDTYSSTEDEDDSDFLNTTYTWNLRNVPKLRINDAEAEGELTLGHQAREVPQQEQPQEKQP 371
            |...|.....||..|.:...:.|.:..|          ..|.|..:|..| |.:|.....||.:|
Human   260 AFLGETGLDRTEGRDQTSVNSATLSRTL----------LAAAGGSSLQTQ-RGLPGSSPQQENRP 313

  Fly   372 CLEPEPPK---------VRPATPTPKAPPQESAEGQTQKLLFRLDKLERSW 413
            ..:.|.||         :|....||.:....|::.:.:. .|..::|.:||
Human   314 GDKAEAPKGQEQCRLETIRDPKDTPFSTCSSSSDSEPEG-FFLGERLPQSW 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_ZASP52-like 41..120 CDD:467281
PRICKLE4NP_037529.3 PET_OEBT 1..116 CDD:193603
LIM1_Testin_like 124..181 CDD:188726
LIM2_Testin_like 187..242 CDD:188727
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.