Sequence 1: | NP_001137648.1 | Gene: | CG42319 / 36473 | FlyBaseID: | FBgn0259219 | Length: | 452 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001007623.1 | Gene: | Pdlim2 / 290354 | RGDID: | 1359203 | Length: | 349 | Species: | Rattus norvegicus |
Alignment Length: | 290 | Identity: | 65/290 - (22%) |
---|---|---|---|
Similarity: | 107/290 - (36%) | Gaps: | 85/290 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 WGFLITGGAEFHMPLTVFQVTPNGLADKAGIRLGDIILEINEEDASQLTLSQAHEKINSTPKKIH 115
Fly 116 FLLRNMEEDDPMGQFEAGEEKSIVMRV----------------------------PKP-----LP 147
Fly 148 PPSGRIRASSIEMRLLEMQRKLSAIAEIPKILCSTLAT-----VSQNFGRMSESEVDEDDVGEEE 207
Fly 208 AYVQ-------RKFSYDEDALDFELRNGEQAGDTDSDEEDLVLVREEDAEDVDVPKGAKQSKLLK 265
Fly 266 DV--------TP---ESDYASEANYPANEA 284 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42319 | NP_001137648.1 | PDZ_signaling | 45..119 | CDD:238492 | 27/67 (40%) |
Pdlim2 | NP_001007623.1 | PDZ_signaling | 9..80 | CDD:238492 | 27/66 (41%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 72..95 | 4/25 (16%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 108..147 | 6/38 (16%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 168..212 | 9/53 (17%) | |||
DUF4749 | <190..252 | CDD:292558 | 10/73 (14%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 250..272 | 5/21 (24%) | |||
LIM_Mystique | 283..335 | CDD:188833 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0003437 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24214 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.100 |