DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and Pdlim7

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_038951356.1 Gene:Pdlim7 / 286908 RGDID:628769 Length:464 Species:Rattus norvegicus


Alignment Length:420 Identity:84/420 - (20%)
Similarity:144/420 - (34%) Gaps:158/420 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VDSDAYATKDDSRWGFLITGGAEFHMPLTVFQVTPNGLADKAGIRLGDIILEINEEDASQLTLSQ 102
            :||.....:..:.|||.:.||.:|::||::.::||.|.|.:||:.:||.:|.|:.|:|..||..:
  Rat     1 MDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGSLTHIE 65

  Fly   103 AHEKINSTPKKIHFLLRNMEEDDPMGQFEAGEEKSIVMRVPKPLPPPSGRIRASSIEMRLLEMQR 167
            |..||.:                      .||..|:            |..||...:.:   .|:
  Rat    66 AQNKIRA----------------------CGERLSL------------GLSRAQPAQSK---PQK 93

  Fly   168 KLSAIAEIPKILCSTLATVSQN---FGRMSESEVDEDDVGEEEAYVQRKFSYDEDALDFELRNGE 229
            .|:..|:.|:...:..|::::.   ||....:                     :.||.   :||.
  Rat    94 ALTPPADPPRYTFAPSASLNKTARPFGAPPPT---------------------DSALS---QNGC 134

  Fly   230 QAGDTDSDEEDLVLVREEDAEDVDVPKGAKQSKLLKDVTPESDYASEANYPANEASDDTESDDED 294
            :                        |..::|  ||:.:.|::.        .....::|| |...
  Rat   135 R------------------------PLTSQQ--LLRQLVPDAS--------KQRLMENTE-DWRP 164

  Fly   295 EPGS--TVYFMKLPAAAAEDTYSSTEDEDDSDFLNTTYTWNLRNVPKLRINDAEAEGELTLGHQA 357
            .||:  :..|..|    |..|.:....:.|.:|:..:     ..||:   .:|.|          
  Rat   165 RPGTGQSRSFRIL----AHLTGTEFMQDPDEEFMKKS-----SQVPR---TEAPA---------- 207

  Fly   358 REVPQQEQPQEKQPCLEPEPPKVRPATPTPKAPP---------QESAEGQTQKLLFRLDKLERSW 413
               |....|||..|         .|.||:|.:.|         :..|..:|..:|.|..:.....
  Rat   208 ---PASTIPQESWP---------GPTTPSPTSRPPWAVDPAFAERYAPDKTSTVLTRHSQPATPT 260

  Fly   414 PWADREKIIY--------------KQSTCH 429
            |..:|..|:.              |...||
  Rat   261 PLQNRTSIVQAAAGGGTGGGSNNGKTPVCH 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 25/73 (34%)
Pdlim7XP_038951356.1 PDZ_signaling 5..79 CDD:238492 27/95 (28%)
PHA03247 <11..261 CDD:223021 76/379 (20%)
DUF4749 <163..192 CDD:406377 7/32 (22%)
LIM1_Enigma 289..340 CDD:188836 2/2 (100%)
LIM2_Enigma 348..399 CDD:188840
LIM3_Enigma 407..461 CDD:188842
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10378
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.