DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and PDLIM3

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_055291.2 Gene:PDLIM3 / 27295 HGNCID:20767 Length:364 Species:Homo sapiens


Alignment Length:312 Identity:67/312 - (21%)
Similarity:106/312 - (33%) Gaps:116/312 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WGFLITGGAEFHMPLTVFQVTPNGLADKAGIRLGDIILEINEEDASQLTLSQAHEKINS------ 109
            |||.::||.:|:.||.:.::||...|..|.:..||:||.|:......:|.:.|.::|.:      
Human    13 WGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAAAHQLC 77

  Fly   110 -----------TPK-----KIHFLLRNMEEDDPMGQFEAGEEKSIVMRVPKPLPPPSGRIRASSI 158
                       :|:     |.|....|:|.:...|.:  .|.|..:.  |||...|.   |:|. 
Human    78 LKIDRGETHLWSPQVSEDGKAHPFKINLESEPQDGNY--FEHKHNIR--PKPFVIPG---RSSG- 134

  Fly   159 EMRLLEMQRKLSAIAEIPKILCSTLATVSQNFGRMSESEVD--------EDDVGEEEA------- 208
                                 |||.:.:....||.:.|.|.        :..|..:.|       
Human   135 ---------------------CSTPSGIDCGSGRSTPSSVSTVSTICPGDLKVAAKLAPNIPLEM 178

  Fly   209 ------YVQRKFS-----YDEDALDFELRNGEQA---GDTDSDEEDLVLVREEDAEDVDVPKGAK 259
                  .|..:|:     |.:|.: .|...|:.:   |:|.       |:.|..|          
Human   179 ELPGVKIVHAQFNTPMQLYSDDNI-METLQGQVSTALGETP-------LMSEPTA---------- 225

  Fly   260 QSKLLKDVTPESDYASEANYPANEASDDTES----------DD--EDEPGST 299
                  .|.||||.....:...||.:...:|          ||  :|.|..|
Human   226 ------SVPPESDVYRMLHDNRNEPTQPRQSGSFRVLQGMVDDGSDDRPAGT 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 23/89 (26%)
PDLIM3NP_055291.2 PDZ_signaling 2..80 CDD:238492 20/66 (30%)
DUF4749 184..263 CDD:374237 20/102 (20%)
LIM_ALP 294..346 CDD:188834
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.