DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42319 and LNX2

DIOPT Version :9

Sequence 1:	NP_001137648.1	Gene:	CG42319 / 36473	FlyBaseID:	FBgn0259219	Length:	452	Species:	Drosophila melanogaster
Sequence 2:	NP_699202.1	Gene:	LNX2 / 222484	HGNCID:	20421	Length:	690	Species:	Homo sapiens

Alignment Length:	113	Identity:	29/113 - (25%)
Similarity:	49/113 - (43%)	Gaps:	19/113 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly    52 GFLITGG---AEFHMPLTVFQVTPNG-LADKAGIRLGDIILEINEEDASQLTLSQAHEKINSTPK 112
            |..:.||   ....:|:.|..|.|:| ||....|:.||::|.||..|.:.|:.|:|...:.::..
Human   480 GMTVAGGRGSKSGELPIFVTSVPPHGCLARDGRIKRGDVLLNINGIDLTNLSHSEAVAMLKASAA 544

  Fly   113 KIHFLLRNME-----------EDDPM----GQFEAGEEKSIVMRVPKP 145
            .....|:.:|           |:.|.    .:::|....|.||.:..|
Human   545 SPAVALKALEVQIVEEATQNAEEQPSTFSENEYDASWSPSWVMWLGLP 592

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42319	NP_001137648.1	PDZ_signaling	45..119	CDD:238492	20/70 (29%)
LNX2	NP_699202.1	mRING-HC-C3HC3D_LNX2	45..89	CDD:319694
		modified RING-HC finger (C3HC3D-type)	50..87	CDD:319694
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	198..224
		NPXY motif	208..211
		PDZ	230..316	CDD:214570
		PDZ	336..422	CDD:214570
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	418..455
		PDZ_signaling	466..542	CDD:238492	20/61 (33%)
		PDZ_signaling	599..683	CDD:238492
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3528
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900