Sequence 1: | NP_001137648.1 | Gene: | CG42319 / 36473 | FlyBaseID: | FBgn0259219 | Length: | 452 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001240665.1 | Gene: | Pdlim2 / 213019 | MGIID: | 2384850 | Length: | 349 | Species: | Mus musculus |
Alignment Length: | 286 | Identity: | 67/286 - (23%) |
---|---|---|---|
Similarity: | 110/286 - (38%) | Gaps: | 77/286 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 WGFLITGGAEFHMPLTVFQVTPNGLADKAGIRLGDIILEINEEDASQLTLSQAHEKINSTPKKIH 115
Fly 116 FLLRNMEEDDPMGQFEAGEEK---------------------------SIVMRVPKP-----LPP 148
Fly 149 PSGRIRASSIEMRLLEMQRKLSAIAEIPKILCSTLAT-----VSQNFGRMSESE----VDEDDVG 204
Fly 205 EEEAYVQRKFSYDEDALDFELRNGEQAGDTDSDEEDLVLVREEDAEDVDVPKGAKQSKLLKDV-- 267
Fly 268 ------TP---ESDYASEANYPANEA 284 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42319 | NP_001137648.1 | PDZ_signaling | 45..119 | CDD:238492 | 26/67 (39%) |
Pdlim2 | NP_001240665.1 | PDZ_signaling | 9..80 | CDD:238492 | 26/66 (39%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 74..147 | 13/74 (18%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 169..212 | 10/49 (20%) | |||
DUF4749 | <198..252 | CDD:406377 | 10/72 (14%) | ||
LIM_Mystique | 283..335 | CDD:188833 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0003437 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24214 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R15300 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.130 |