DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and Pdlim2

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001240665.1 Gene:Pdlim2 / 213019 MGIID:2384850 Length:349 Species:Mus musculus


Alignment Length:286 Identity:67/286 - (23%)
Similarity:110/286 - (38%) Gaps:77/286 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WGFLITGGAEFHMPLTVFQVTPNGLADKAGIRLGDIILEINEEDASQLTLSQAHEKINSTPKKIH 115
            |||.|:||.:||.|:.|.:||..|.|:.|.:|.||||:.||.:.|..:..::|..||..:...:.
Mouse    13 WGFRISGGRDFHTPIIVTKVTERGKAEAADLRPGDIIVAINGQSAENMLHAEAQSKIRQSASPLR 77

  Fly   116 FLLRNMEEDDPMGQFEAGEEK---------------------------SIVMRVPKP-----LPP 148
            ..|...:...| ||.. ||..                           |.|...|:|     .||
Mouse    78 LQLDRSQTASP-GQTN-GEGSLEVLATRFQGSLRTHRDSQSSQRSACFSPVSLSPRPCSPFSTPP 140

  Fly   149 PSGRIRASSIEMRLLEMQRKLSAIAEIPKILCSTLAT-----VSQNFGRMSESE----VDEDDVG 204
            |:..:..|..:|.....|    ::...|.:..:...|     .||..|..|.|:    |.....|
Mouse   141 PTSPVALSKEDMIGCSFQ----SLTHSPGLAAAHHLTYPGHPTSQQAGHSSPSDSAVRVLLHSPG 201

  Fly   205 EEEAYVQRKFSYDEDALDFELRNGEQAGDTDSDEEDLVLVREEDAEDVDVPKGAKQSKLLKDV-- 267
            ...:   .:||    :||.|            ::.::..:.:|:.:....|:.:...:||::.  
Mouse   202 RPSS---PRFS----SLDLE------------EDSEVFKMLQENRQGRAAPRQSSSFRLLQEALE 247

  Fly   268 ------TP---ESDYASEANYPANEA 284
                  ||   .|..:|:|:.|.:.|
Mouse   248 AEERGGTPAFVPSSLSSQASLPTSRA 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 26/67 (39%)
Pdlim2NP_001240665.1 PDZ_signaling 9..80 CDD:238492 26/66 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 74..147 13/74 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..212 10/49 (20%)
DUF4749 <198..252 CDD:406377 10/72 (14%)
LIM_Mystique 283..335 CDD:188833
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003437
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R15300
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.130

Return to query results.
Submit another query.