DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and C52A11.3

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_496315.2 Gene:C52A11.3 / 183712 WormBaseID:WBGene00008257 Length:131 Species:Caenorhabditis elegans


Alignment Length:108 Identity:22/108 - (20%)
Similarity:33/108 - (30%) Gaps:52/108 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KVSCGIGDTDGYPAFDVDSDAYATKDDSRWGFLITGGAEFHMPLTVFQVTPNGLADKAGIRLGDI 86
            |:..|:|..|.                   |.|||            .|.|..:|.:. :::||.
 Worm    61 KIGMGVGVRDR-------------------GILIT------------TVVPGSVAAEK-LKVGDR 93

  Fly    87 ILEIN--------------EEDASQLTLSQAHEKINSTPKKIH 115
            ||.:|              :....:|.|..|.      |.|:|
 Worm    94 ILAVNGRPILDQRSVVKSVKASGQRLYLQIAR------PHKVH 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 18/85 (21%)
C52A11.3NP_496315.2 PDZ_signaling 51..124 CDD:238492 18/94 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.