DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and C50F7.3

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_501268.1 Gene:C50F7.3 / 183682 WormBaseID:WBGene00016843 Length:313 Species:Caenorhabditis elegans


Alignment Length:288 Identity:52/288 - (18%)
Similarity:98/288 - (34%) Gaps:89/288 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PESKSKAPIIKVSCGIGDTDGYPAFDVDSDAYATKDDSRWGFLITGGAE--FHMPLTVFQV---- 70
            |.:|....:|:....|....|:|... ..::|:|..      |:....:  ||:.|.:.::    
 Worm    93 PCAKMTYKVIRFKRHIPRPSGFPPLQ-KHESYSTDT------LVLYNLKKVFHLGLDIKEIEGKI 150

  Fly    71 -----TPNGLADKAGIRLGDIILEINEEDASQLTLSQAHEKINSTPKKIHFLLRN-------MEE 123
                 ..|.|.|.. ..:|:.||:::.|  ..|:.:..:|::..:     .|:||       :..
 Worm   151 VVCDLVENSLGDMT-FSVGETILDVDGE--KPLSCTGFNERVRKS-----LLIRNYCLVTVEIPS 207

  Fly   124 DDPMGQFEAGEEKSIVMRVPK--PLPPPSGRIRASSIEMRLLEMQRKLSAIAEIPKILCSTLATV 186
            .||:......:....|...|:  .|||.:....|..|     .:.||.....::..||      :
 Worm   208 TDPLKNLLRNQITKTVKEAPRIHKLPPDAAAYGAEGI-----AVLRKFGGGEQLKPIL------L 261

  Fly   187 SQNFGRMSESEVDEDDVGEEEAYVQRKFSYDEDALDFELRNGEQAGDTDSDEEDLVLVREEDAED 251
            ::...:.:||           |:.|.|.                               ||..::
 Worm   262 AEPIPKSNES-----------AHSQLKI-------------------------------EEKVKE 284

  Fly   252 VDVPKGAKQSKLLKDVTPESDYASEANY 279
            .|||.| ..|:|...:.|.....:|:.:
 Worm   285 GDVPSG-WNSRLFVRLPPMKSAETESTF 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 15/84 (18%)
C50F7.3NP_501268.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.