DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and smz-2

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_491965.1 Gene:smz-2 / 172415 WormBaseID:WBGene00020661 Length:274 Species:Caenorhabditis elegans


Alignment Length:295 Identity:56/295 - (18%)
Similarity:101/295 - (34%) Gaps:96/295 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 NMEEDDPMGQFEAGEEKSIVMRVPKPLPPPSGRIRASSIEMRLLEMQRKLSA------------- 171
            :|||.:|:|  ....:|.::.::      .:|.|  |..::|:.:..:|::.             
 Worm    12 DMEEGEPLG--ATPNDKLVITKI------QAGTI--SEGKLRIGDQVKKVNGQNCKDCNDFFRAL 66

  Fly   172 --IAEIPKILCSTLATVSQNFGRMSESE----VDEDD---VGEEEAYVQRKFSYDEDALDFELRN 227
              .|...||      ||:::..:..|.|    :.||.   :...|.||     |:...|.: ::|
 Worm    67 RFAAPCAKI------TVNRDEKKAEELEARVHIPEDRAKIIQRREGYV-----YELATLVW-VQN 119

  Fly   228 GEQAGDTDSDEEDLVLVREEDAEDVDVPKGAKQSKLL--------KDVTPESDYASEANYPANEA 284
            |.:.|......::.|||...|       .|:...|.|        .|..|.||         .:.
 Worm   120 GPKLGLGIKHFQNRVLVSRVD-------PGSLAEKCLVLGDHLCDVDGIPVSD---------KDV 168

  Fly   285 SDDTESDDEDEPGSTVYFMKLPAAAAEDTYSSTEDEDDSDFLNTTYTWNLRNVPKLRIND----- 344
            :.|....:..|.|...:.::.|           :..|...:.......||...|.:::|:     
 Worm   169 ARDLLVKNIQEKGKVTFVVERP-----------DSIDAKQWAKQALATNLMQPPSVQMNEDVKGI 222

  Fly   345 ------------AEAEGELTLGHQAREVPQQEQPQ 367
                        ..|:..::.|..||.|...||.|
 Worm   223 ASQYRQALPGLKPPAKSAMSTGPNARRVSIIEQTQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492
smz-2NP_491965.1 PDZ_signaling 7..77 CDD:238492 14/80 (18%)
PDZ_signaling 114..188 CDD:238492 18/90 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.