DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and Pdzd3

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_573489.2 Gene:Pdzd3 / 170761 MGIID:2429554 Length:498 Species:Mus musculus


Alignment Length:295 Identity:63/295 - (21%)
Similarity:109/295 - (36%) Gaps:90/295 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 YATKDDSRWGFLITGGAE--FHMPLTVFQVTPNGLADKAGIRLGDIILEINEEDASQLTLSQAHE 105
            :..||:..:||.:|.|:.  |.:.|:.     .|.|::||:..|..:||:|.....:||.:|.:.
Mouse   159 HVVKDEGGFGFSVTHGSRGPFWLVLSA-----GGAAERAGVPPGARLLEVNGASVEKLTYNQLNR 218

  Fly   106 KINSTPKKIHFLLRNMEEDDPMGQFEAGEEKSIVMRVPKPLPPPSGRIRASSIEMRLLEMQRKLS 170
            |:..:..::..|:..:|.::...|            :..||..|                     
Mouse   219 KLWQSGDQVTLLVAGLEVEEQCHQ------------LGMPLAAP--------------------- 250

  Fly   171 AIAE---IP-KILCSTLATVSQNFGRMSESEVDEDD-VGEEEAYVQRKFSYDED-ALDFELRNGE 229
             :||   :| |..|..:....:.||.:...|...|. :|:        |.:|.| .|..: :.|.
Mouse   251 -LAEGWALPAKPRCLNIEKGPEGFGFLLREEKGLDGRLGQ--------FLWDVDPGLPAD-KAGM 305

  Fly   230 QAGDTDSDEEDLVLVREEDAEDVD--------VPKGAKQSKLLKDVTPESD-------------- 272
            :|||.      ||.|..|..:.:.        ..:|:..|.::.|  ||:|              
Mouse   306 KAGDR------LVAVAGESVDGLGHEETVSRIRAQGSCVSLIVVD--PEADRFFSMVRLSPLLFL 362

  Fly   273 YASEANYPANEASDDTESDDEDEP----GSTVYFM 303
            ..:|...|....:.|...:|..||    ||...|:
Mouse   363 ENTEIAAPPLAETKDLPVEDTVEPSGLAGSCQCFL 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 21/75 (28%)
Pdzd3NP_573489.2 PDZ_signaling 47..127 CDD:238492
PDZ_signaling 155..232 CDD:238492 21/77 (27%)
PDZ 260..345 CDD:214570 22/101 (22%)
PDZ_signaling 407..471 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.