DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and Slc9a3r2

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_446263.2 Gene:Slc9a3r2 / 116501 RGDID:620380 Length:337 Species:Rattus norvegicus


Alignment Length:309 Identity:64/309 - (20%)
Similarity:112/309 - (36%) Gaps:65/309 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LITG--GAEFHM-------PLTVFQVTPNGLADKAGIRLGDIILEINEEDASQLTLSQAHEKINS 109
            |:.|  |..||:       ...:.:|.|...|:.|.:|.||.::|:|..:....|..|..::|.:
  Rat    14 LVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGVNVEGETHHQVVQRIKA 78

  Fly   110 TPKKIHFLLRNMEEDDPM--GQFEAGEEKSIVMRVPKPLPPP------------SGRIRASSIEM 160
            ...:...|:.:.|.|:.:  .|....||.:     .:.|||.            ||.:.:.:.:.
  Rat    79 VEGQTQLLVVDKETDEELCRRQLTCTEEMA-----HRGLPPAHNPWEPKPDWACSGSLGSDTGQK 138

  Fly   161 RL----LEMQRKLSAIAEIPKILCSTLATVSQNFGRMSES-------------------EVDEDD 202
            .:    .|::.:|..:...|:.....|.:.....|:...|                   ||:..:
  Rat   139 DVNGPPRELRPRLCHLRRGPQGYGFNLHSDKSRPGQYIRSVDPGSPASLSGLRAQDRLIEVNGQN 203

  Fly   203 V-GEEEAYVQRKFSYDEDALDFELRNGEQAGDTDSDEEDLVLVREEDAEDVDVPKGAKQSKLLKD 266
            | |...|.|..:....||    |.|......:||...:.|.:|..||..:..:|........|..
  Rat   204 VEGLRHAEVVARIKAQED----EARLLVVDPETDEHFKRLRVVPTEDHVEGPLPSPVTNGTSLAQ 264

  Fly   267 VTPESDYASEANYPANEASDDTES----DDEDEPGSTVYFMKLPAAAAE 311
            :...|..:|.::.|.:|..::..|    |...|.|     :.|...|||
  Rat   265 LNGGSVCSSRSDLPGSEKDNEDGSAWKRDPFQESG-----LHLSPTAAE 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 18/73 (25%)
Slc9a3r2NP_446263.2 PDZ_signaling 9..88 CDD:238492 18/73 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..146 2/18 (11%)
PDZ_signaling 149..228 CDD:238492 15/82 (18%)
EBP50_C 232..337 CDD:401087 20/82 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..337 15/68 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.