DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and Pdlim3

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_446102.2 Gene:Pdlim3 / 114108 RGDID:620427 Length:364 Species:Rattus norvegicus


Alignment Length:298 Identity:61/298 - (20%)
Similarity:108/298 - (36%) Gaps:105/298 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WGFLITGGAEFHMPLTVFQVTPNGLADKAGIRLGDIILEINEEDASQLTLSQAHEKINS------ 109
            |||.::||.:|:.||.:.::||...|:.|.:..||:||.|:......:|.:.|.::|.:      
  Rat    13 WGFRLSGGIDFNQPLVITRITPGSKAEAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLC 77

  Fly   110 -----------TPK-----KIHFLLRNME-EDDPMGQFEAGEEKSIVMRVPKPLPPPSGRIRASS 157
                       :|:     |.|....|:| |...:..|   |.|..:.  |||...|.   |.|.
  Rat    78 LKIDRAETRLWSPQVSEDGKAHPFKINLEAEPQDVNYF---EHKHNIR--PKPFIIPG---RTSG 134

  Fly   158 IEMRLLEMQRKLSAIAEIPKILCSTLATVSQNFGRMSESEVD--------EDDVGEEEA------ 208
                                  |||.:.:....||.:.|.|.        :..|..:.|      
  Rat   135 ----------------------CSTPSGIDCGSGRSTPSSVSTVSTICPGDLKVAAKMAPNIPLE 177

  Fly   209 -------YVQRKFS-----YDEDALDFELRNGEQA---GDTDSDEE---------DLVLVREEDA 249
                   .|..:|:     |.:|.: .|...|:.:   |:|.|..|         |:..:..::.
  Rat   178 MELPGVKIVHAQFNTPMQLYSDDNI-METLQGQVSTALGETPSMSEPTASVPPQSDVYRMLHDNR 241

  Fly   250 EDVDVPKGAKQSKLLKDVTPESDYASEANYPANEASDD 287
            ::...|:.:...::|:::             .|:.|||
  Rat   242 DEPAAPRQSGSFRVLQEL-------------VNDGSDD 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 23/89 (26%)
Pdlim3NP_446102.2 PDZ_signaling 2..80 CDD:238492 20/66 (30%)
DUF4749 184..263 CDD:406377 14/92 (15%)
LIM_ALP 294..346 CDD:188834
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.