DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and PDLIM5

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001243355.2 Gene:PDLIM5 / 10611 HGNCID:17468 Length:625 Species:Homo sapiens


Alignment Length:295 Identity:66/295 - (22%)
Similarity:106/295 - (35%) Gaps:75/295 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WGFLITGGAEFHMPLTVFQVTPNGLADKAGIRLGDIILEINEEDASQLTLSQAHEKINSTPKKIH 115
            |||.:.||.:|:||||:..:...|.|.:|.:|:||::|.|:..:|..:|..:|..||......::
Human    14 WGFRLQGGKDFNMPLTISSLKDGGKAAQANVRIGDVVLSIDGINAQGMTHLEAQNKIKGCTGSLN 78

  Fly   116 FLLRNMEEDDPMGQFEAGEEKSIVMRVPKPLPPPSGRIRASSI----EMRLLEMQRKLSAIAEIP 176
            ..|:.                  ....|||.|.|..:...:|:    ...|.|.||:        
Human    79 MTLQR------------------ASAAPKPEPVPVQKPTVTSVCSETSQELAEGQRR-------- 117

  Fly   177 KILCSTLATVSQNFGRMSESEVDEDDVGEEEAYVQRKFSYDEDALDFELRNGEQAGDTDSDEEDL 241
                          |...:|:.....:..:..  .||...:.....:.:       .|.||....
Human   118 --------------GSQGDSKQQNGKIPPKRP--PRKHIVERYTEFYHV-------PTHSDASKK 159

  Fly   242 VLVREEDAEDVDVPKGAKQS---KLLKDVT-------PESDYASEANYPANEASDDTESDDEDEP 296
            .|:  ||.||.....|..||   ::|..:|       .|:|...:|.:  :.|.:|........|
Human   160 RLI--EDTEDWRPRTGTTQSRSFRILAQITGTEHLKESEADNTKKAKF--DSALEDLPKSGPHPP 220

  Fly   297 --------GSTVYFMKLPAAAAEDTYSSTEDEDDS 323
                    ||.|..:...|.......|||.:.:||
Human   221 ATPQVLTIGSQVATLSKVATTYSSLSSSTGNVEDS 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 23/67 (34%)
PDLIM5NP_001243355.2 PDZ_signaling 10..82 CDD:238492 23/67 (34%)
DUF4749 105..201 CDD:406377 23/128 (18%)
LIM1_ENH 449..500 CDD:188837
LIM 508..559 CDD:413332
LIM3_ENH 567..621 CDD:188843
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.