DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and cytip

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_003199223.2 Gene:cytip / 100537036 ZFINID:ZDB-GENE-140106-76 Length:343 Species:Danio rerio


Alignment Length:229 Identity:45/229 - (19%)
Similarity:86/229 - (37%) Gaps:52/229 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WGFLITGGAEFHMPLTVFQVTPNGLADKAGIRLGDIILEINEEDASQLTLSQAHEKINSTPKKIH 115
            :|..:...:...|...|.:|.....|:.||:..|||||.:|.....           .||.:.|.
Zfish    96 YGLKVKNTSMVEMCTFVCRVQDGSAAETAGLTAGDIILSVNGVSIE-----------GSTHQNII 149

  Fly   116 FLLRNMEEDDPMGQFEAGEEKSIVMRVPKPLPPPSGRIRASSIEMRLLEMQRKLSAIAEIPKILC 180
            .|:|               |.|..::    |...||.:      |:.:|:::|:..:.:..:...
Zfish   150 ELIR---------------ESSNTLK----LETVSGSV------MKRIELEKKMHYLKQTLREKW 189

  Fly   181 STLATVSQNFGRMSESEVDEDDVGEEEAYVQRKFSYDEDALDFELRNGEQAGDTDSDEEDLVLVR 245
            ..|.:::     :.|..:.:.::.|...|:    |.| ..:......| ::|...|.:.....:.
Zfish   190 VELQSLT-----LKEKRLTQGNLNESAQYL----SVD-SVMSLSSPMG-RSGQRFSSDSSCRSIM 243

  Fly   246 EEDAEDVDVPKGAKQSKLLKDVTPESDYASEANY 279
            .:|:||     ||..|.:..|.:|.|...|..::
Zfish   244 TDDSED-----GAFMSSVFDDSSPLSPIESSGSF 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 17/67 (25%)
cytipXP_003199223.2 PDZ_signaling 78..162 CDD:238492 20/95 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.