DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and SYNJ2BP-COX16

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001189476.1 Gene:SYNJ2BP-COX16 / 100529257 HGNCID:48350 Length:191 Species:Homo sapiens


Alignment Length:164 Identity:32/164 - (19%)
Similarity:64/164 - (39%) Gaps:26/164 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 TKDDSRWGFLITGGAEFH-----MPLTVFQVTPNGLADKAG-IRLGDIILEINEEDASQLTLSQA 103
            |:..|..||.|.||.:..     ..:.|.::..||.|...| ::.||.||.:|.:|...|....|
Human    17 TRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDA 81

  Fly   104 HEKINSTPKKIHFLL--RNMEEDDPMGQFEAGEEKSIVMRVPKPLPPPSGRIRASSIEMRLLEMQ 166
            .:...:....:...:  |...::.|:|....|:        |..:|.....:...::.|...|::
Human    82 VDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEGD--------PSGIPIFMVLVPVFALTMMDPELE 138

  Fly   167 RKLSAIAEIPKILCSTLATVSQNFGRMSESEVDE 200
            :||.          ....::...:.::.:|:.|:
Human   139 KKLK----------ENKISLESEYEKIKDSKFDD 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 20/81 (25%)
SYNJ2BP-COX16NP_001189476.1 PDZ_signaling 13..97 CDD:238492 20/79 (25%)
DegQ <16..77 CDD:223343 18/59 (31%)
COX16 <133..173 CDD:290843 5/40 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.