DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and grip2

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_031757025.1 Gene:grip2 / 100495373 XenbaseID:XB-GENE-854056 Length:1115 Species:Xenopus tropicalis


Alignment Length:275 Identity:64/275 - (23%)
Similarity:100/275 - (36%) Gaps:68/275 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DTDGYPAFDVDSDAYATKDDSRWGFLITGGAEFHMPLTVFQVTPNGLADKAG-IRLGDIILEINE 92
            :|.|...:.|:...|.    ...|..|:|..|...|:.:..:|..|||::.| |.:||.||.||.
 Frog   691 ETSGAIIYTVELKRYG----GPLGITISGTEEPFDPIVISGLTKRGLAERTGAIHIGDRILAINN 751

  Fly    93 EDASQLTLSQAHEKINSTPKKIHFLLRNMEEDDPMGQFEAGEEKSIVMRVPK------PLPPPSG 151
            .......||:|          ||.|..            |||  ::.:::.|      |......
 Frog   752 VSLKGKPLSEA----------IHLLQM------------AGE--TVTLKIKKQAERIFPQRLSDS 792

  Fly   152 RIRASSIEMRLLEMQR--KLSAI--AEIPKILCSTLAT----------------VSQNFG----- 191
            ....|..|..|.:.|:  |||.|  ..:|.: .|.|.:                |.|..|     
 Frog   793 MNEGSDPEDDLTDSQKTSKLSDIYSTAVPSV-DSALESWDGSGIDAGYGSQGTYVPQAVGISLHP 856

  Fly   192 ---RMSESEVDEDDVGEEEAYVQRKFSYDEDALDFELRNGEQAGDTDSDEED-LVLVREEDAEDV 252
               |.|..:.....|...::|.....|::|...:...|...|....::|.:| ...|..|..||:
 Frog   857 HEWRTSRQKSSTPPVEHRKSYPFLDGSFNEQDWEKPTRYPSQPNGLEADHDDSFWRVFGEALEDL 921

  Fly   253 DVPKGAKQSKLLKDV 267
            :.   ..||:||:::
 Frog   922 ET---CGQSELLREI 933

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 23/74 (31%)
grip2XP_031757025.1 PDZ_signaling 87..169 CDD:238492
PDZ_signaling 187..272 CDD:238492
PDZ_signaling 287..370 CDD:238492
PDZ_signaling 499..585 CDD:238492
PDZ_signaling 598..681 CDD:238492
PDZ_signaling 697..778 CDD:238492 28/108 (26%)
PDZ_signaling 1007..1084 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.