DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and pdlim2

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_002932747.1 Gene:pdlim2 / 100488396 XenbaseID:XB-GENE-941744 Length:149 Species:Xenopus tropicalis


Alignment Length:94 Identity:20/94 - (21%)
Similarity:40/94 - (42%) Gaps:16/94 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 EDASQLTLSQAHEKINSTPKKIHF--LLRNMEEDDPMGQFEAGEEKSIVMR----VP-------- 143
            :|:....:.|.:.:..::|::.:.  ||:...|.:|.|.|....:.|..::    ||        
 Frog     6 QDSEVYKMLQGNLENRTSPRQSNSFKLLQEAMESNPDGGFSMPSKFSPTIQKQNSVPNNQSPVAQ 70

  Fly   144 -KPLPPPSGRIR-ASSIEMRLLEMQRKLS 170
             :|...||..:| .....|.:.|:..|:|
 Frog    71 NRPTNSPSAALRTCEKCSMTISEVAVKIS 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 4/27 (15%)
pdlim2XP_002932747.1 DUF4749 <6..40 CDD:374237 6/33 (18%)
LIM 84..136 CDD:351770 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003437
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.