DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4714 and SBSN

DIOPT Version :9

Sequence 1:	NP_610857.2	Gene:	CG4714 / 36470	FlyBaseID:	FBgn0033819	Length:	732	Species:	Drosophila melanogaster
Sequence 2:	NP_001159506.1	Gene:	SBSN / 374897	HGNCID:	24950	Length:	590	Species:	Homo sapiens

Alignment Length:	72	Identity:	22/72 - (30%)
Similarity:	31/72 - (43%)	Gaps:	8/72 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly    50 GNQPAGDEPREEKPQIESGA-ITAQVATEEGQEAETTEHVAI-----EATELGNEVQQTEASDEL 108
            |.||...|..:|..|...|. .|.:.|.:|..:|....|..:     ||.:||..|  ..|:|:.
Human   443 GVQPGVHEAGKEAGQFGQGVHHTLEQAGKEADKAVQGFHTGVHQAGKEAEKLGQGV--NHAADQA 505

  Fly   109 SPEEKKL 115
            ..|.:||
Human   506 GKEVEKL 512

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4714	NP_610857.2	DUF4201	550..726	CDD:290581
SBSN	NP_001159506.1	Glutenin_hmw	<146..>522	CDD:281191	22/72 (31%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	182..213
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	242..266
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	297..338
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	545..570
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_2EAT3
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900