DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp20 and IQGAP1

DIOPT Version :9

Sequence 1:NP_001014522.2 Gene:Mp20 / 36468 FlyBaseID:FBgn0002789 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_003861.1 Gene:IQGAP1 / 8826 HGNCID:6110 Length:1657 Species:Homo sapiens


Alignment Length:168 Identity:49/168 - (29%)
Similarity:79/168 - (47%) Gaps:22/168 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KEAQEWIEAIIAEKFPAGQSYEDVLKDGQVLCKLINVLSPNAV----------PKVNSSGGQFKF 75
            :||:.|:||.:.|..|.....|:.|::|..|.||.|..||..|          .:..::|..|:.
Human    48 EEAKRWMEACLGEDLPPTTELEEGLRNGVYLAKLGNFFSPKVVSLKKIYDREQTRYKATGLHFRH 112

  Fly    76 MENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFALGRATYKHADFKGPFLGPKPAD- 139
            .:|:..:..|:.|.|:|.|...:|.|:|::|::......|.||....:|..      |.|:..| 
Human   113 TDNVIQWLNAMDEIGLPKIFYPETTDIYDRKNMPRCIYCIHALSLYLFKLG------LAPQIQDL 171

  Fly   140 ECKRDFTEEQLKAGQTIV---GLQ--AGSNKGATQAGQ 172
            ..|.|||||::...:|.:   |:|  |.|..|...|.:
Human   172 YGKVDFTEEEINNMKTELEKYGIQMPAFSKIGGILANE 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mp20NP_001014522.2 SCP1 7..179 CDD:227526 49/168 (29%)
CH 18..121 CDD:237981 32/109 (29%)
Calponin 158..178 CDD:278814 6/17 (35%)
IQGAP1NP_003861.1 CH 45..159 CDD:237981 32/110 (29%)
WW 685..710 CDD:238122
IQ 774..796 CDD:197470
C1 956..1274
RasGAP 992..1344 CDD:214617
RasGAP_IQGAP1 1003..1382 CDD:213335
C2 1276..1657
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1410..1448
RasGAP_C 1452..1580 CDD:281787
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.