DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp20 and IQG1

DIOPT Version :9

Sequence 1:NP_001014522.2 Gene:Mp20 / 36468 FlyBaseID:FBgn0002789 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_015082.1 Gene:IQG1 / 855834 SGDID:S000006163 Length:1495 Species:Saccharomyces cerevisiae


Alignment Length:140 Identity:48/140 - (34%)
Similarity:68/140 - (48%) Gaps:17/140 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EAQEWIEAIIAEKFPAGQSYE----DVLKDGQVLCKLINVLSPNAVPKVNSSGG--QFKFMENIN 80
            |.:.||||:|.|..|:  ..|    |.|::|..|.||...::|:....:..:|.  |||..:|||
Yeast   113 EVKIWIEAVIEEALPS--EIELCVGDSLRNGVFLAKLTQRINPDLTTVIFPAGDKLQFKHTQNIN 175

  Fly    81 NFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFALGRATYKHADFKGPFLGPKPA---DECK 142
            .|...::..||||...|:..|||.||:|..|..|:..|.....|    |.|  |..||   ...:
Yeast   176 AFFGLVEHVGVPDSFRFELQDLYNKKNIPQVFETLHILISMINK----KWP--GKTPALTNVSGQ 234

  Fly   143 RDFTEEQLKA 152
            ..||:|::.|
Yeast   235 ISFTKEEIAA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mp20NP_001014522.2 SCP1 7..179 CDD:227526 48/140 (34%)
CH 18..121 CDD:237981 38/104 (37%)
Calponin 158..178 CDD:278814
IQG1NP_015082.1 IQG1 1..1494 CDD:227586 48/140 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.900

Return to query results.
Submit another query.