DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp20 and SCP1

DIOPT Version :9

Sequence 1:NP_001014522.2 Gene:Mp20 / 36468 FlyBaseID:FBgn0002789 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_015012.3 Gene:SCP1 / 854549 SGDID:S000005894 Length:200 Species:Saccharomyces cerevisiae


Alignment Length:192 Identity:71/192 - (36%)
Similarity:103/192 - (53%) Gaps:14/192 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLERAVRAKIASKRNPEMDKEAQEWI-EAIIAEKFPAGQSYEDVLKDGQVLCKLINVLSPNAVPK 65
            ||:..:|....||.:||..:..:.|: ::::.|..|.|...| .||||.|||||.|:|......:
Yeast    11 SLDEDLRQLRESKFSPEAIQNIKIWVYKSVLKEIAPPGDLLE-CLKDGTVLCKLANILYEADTGE 74

  Fly    66 VN-----SSGGQFKFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFALGR-ATYK 124
            .|     ||...|..|:.|:.|....::||||:.::|||:||:||||.|.|..|:.:|.| |..|
Yeast    75 ANHISWKSSKMPFVQMDQISQFLSFSRKYGVPEDELFQTIDLFEKKDPAIVFQTLKSLSRYANKK 139

  Fly   125 HADFKGPFLGPKPADECKRDFTEEQLKAGQTIVG---LQAGSNKGATQA--GQNLGAGRKIL 181
            |.| :.|.|||:.:.:..|...:.:.|..|...|   .:.|..|||:||  |..||..|.|:
Yeast   140 HTD-RFPVLGPQLSTKKPRPPVKSKPKHLQDGTGWSTFEYGYMKGASQATEGVVLGQRRDIV 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mp20NP_001014522.2 SCP1 7..179 CDD:227526 67/183 (37%)
CH 18..121 CDD:237981 42/109 (39%)
Calponin 158..178 CDD:278814 10/24 (42%)
SCP1NP_015012.3 SCP1 15..200 CDD:227526 68/186 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343078
Domainoid 1 1.000 67 1.000 Domainoid score I2342
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I1563
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56098
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - otm46481
orthoMCL 1 0.900 - - OOG6_102866
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 1 1.000 - - X194
TreeFam 00.000 Not matched by this tool.
1211.730

Return to query results.
Submit another query.