DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp20 and TAGLN2

DIOPT Version :9

Sequence 1:NP_001014522.2 Gene:Mp20 / 36468 FlyBaseID:FBgn0002789 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001264153.1 Gene:TAGLN2 / 8407 HGNCID:11554 Length:220 Species:Homo sapiens


Alignment Length:190 Identity:72/190 - (37%)
Similarity:110/190 - (57%) Gaps:11/190 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LERAVRAKIASKRNPEMDKEAQEWI----EAIIAEKFPAGQSYEDVLKDGQVLCKLINVLSPNA- 62
            |.|.|:.||..:.:.::::...:||    ...:....|..:::::.||||.|||:|||.|.|.. 
Human    31 LSREVQQKIEKQYDADLEQILIQWITTQCRKDVGRPQPGRENFQNWLKDGTVLCELINALYPEGQ 95

  Fly    63 --VPKVNSSGGQFKFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFALGRATYKH 125
              |.|:.:|...||.||.|:.|.:|.:.||:...|:||||||:|.|::|.|..|:..||......
Human    96 APVKKIQASTMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGKNMACVQRTLMNLGGLAVAR 160

  Fly   126 AD--FKG-PFLGPKPADECKRDFTEEQLKAGQTIVGLQAGSNKGATQAGQ-NLGAGRKIL 181
            .|  |.| |...||.:.|..|:|::.||:.|:.::|||.|:|:||:|||. ..|..|:||
Human   161 DDGLFSGDPNWFPKKSKENPRNFSDNQLQEGKNVIGLQMGTNRGASQAGMTGYGMPRQIL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mp20NP_001014522.2 SCP1 7..179 CDD:227526 67/182 (37%)
CH 18..121 CDD:237981 41/109 (38%)
Calponin 158..178 CDD:278814 11/20 (55%)
TAGLN2NP_001264153.1 CH 47..154 CDD:366016 39/106 (37%)
Calponin 195..218 CDD:366078 11/22 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144834
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - mtm8439
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 1 1.000 - - X194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.