DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp20 and ATK4

DIOPT Version :9

Sequence 1:NP_001014522.2 Gene:Mp20 / 36468 FlyBaseID:FBgn0002789 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_568491.1 Gene:ATK4 / 832758 AraportID:AT5G27000 Length:987 Species:Arabidopsis thaliana


Alignment Length:179 Identity:48/179 - (26%)
Similarity:79/179 - (44%) Gaps:31/179 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EAQEWIEAII----AEKFPAGQSYEDV---LKDGQVLCKLINVLSPNAVPKV---------NSSG 70
            ||..|:..:|    .:.||...|.|:.   |:.|.|||.::|.::|.:|.||         .::.
plant    49 EAAGWLRDMIGVSNGKDFPGEPSEEEFRLGLRSGIVLCNVLNKVNPGSVSKVVEAPDDVADGAAL 113

  Fly    71 GQFKFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFALGRATYKHADFKGPFLGP 135
            ..|::.|||.||..|::|.|:|.   |:..|:.:......:.|.|.||  .:|.....||. .||
plant   114 SAFQYFENIRNFLVAIEEMGLPS---FEASDMEKGGKSIRIVNCILAL--KSYSEWKLKGE-NGP 172

  Fly   136 -KPADECKRDFTEEQL---KAGQTIVGLQAGSNKGATQAGQNLGAGRKI 180
             :.....|.:|...:|   |:.:..|     |:...||:...|...:.:
plant   173 WRYGSNMKHNFGSRKLFLRKSSEPFV-----SSISRTQSTDMLSTDQPL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mp20NP_001014522.2 SCP1 7..179 CDD:227526 48/176 (27%)
CH 18..121 CDD:237981 34/114 (30%)
Calponin 158..178 CDD:278814 4/19 (21%)
ATK4NP_568491.1 CH 46..158 CDD:278723 32/111 (29%)
KISc_C_terminal 392..723 CDD:276817
KISc 394..727 CDD:214526
DUF4887 <841..977 CDD:292845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4320
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.