DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp20 and tagln

DIOPT Version :9

Sequence 1:NP_001014522.2 Gene:Mp20 / 36468 FlyBaseID:FBgn0002789 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_021337144.1 Gene:tagln / 751758 ZFINID:ZDB-GENE-070912-1 Length:206 Species:Danio rerio


Alignment Length:186 Identity:81/186 - (43%)
Similarity:110/186 - (59%) Gaps:13/186 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LERAVRAKIASKRNPEMDKEAQEWIEAIIAE---KFPAGQ-SYEDVLKDGQVLCKLINVLS-PNA 62
            |.|.|:.||..|.:||::....||:.|....   :..||: .::..||||.|||:|||.|| ...
Zfish    17 LSRQVQDKIEQKYDPELELRLVEWLVAQCGSAVGRPDAGKLGFQAWLKDGCVLCELINSLSKEKP 81

  Fly    63 VPKVNSSGGQFKFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFALGRATYKHAD 127
            |.|:.||...||.||.::.|..|.::|||...|:||||||:|.||:|.|..|:.|||.......|
Zfish    82 VKKIQSSSMAFKQMEQVSQFLNAAEQYGVAKTDIFQTVDLWEGKDLAAVQRTLMALGSIAVTKED 146

  Fly   128 FKGPFLGP-----KPADECKRDFTEEQLKAGQTIVGLQAGSNKGATQAGQNLGAGR 178
              |.|.|.     |.|.|.:|||:::|:|.|:.::|||.|||:||:|||.. |.||
Zfish   147 --GAFRGDPNWFFKKAQENRRDFSDDQMKEGKNVIGLQMGSNRGASQAGMT-GYGR 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mp20NP_001014522.2 SCP1 7..179 CDD:227526 79/182 (43%)
CH 18..121 CDD:237981 47/107 (44%)
Calponin 158..178 CDD:278814 12/19 (63%)
taglnXP_021337144.1 Calponin 21..193 CDD:332521 74/173 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578019
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I4556
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - mtm6375
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 1 1.000 - - X194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.