DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp20 and tagln

DIOPT Version :9

Sequence 1:NP_001014522.2 Gene:Mp20 / 36468 FlyBaseID:FBgn0002789 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001025579.1 Gene:tagln / 594967 XenbaseID:XB-GENE-489085 Length:201 Species:Xenopus tropicalis


Alignment Length:197 Identity:79/197 - (40%)
Similarity:107/197 - (54%) Gaps:32/197 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LERAVRAKIASKRNPEMDKEAQEWI------EAIIAEKFPAGQSYEDVLKDGQVLCKLINVLSPN 61
            :.|.|:::|..|.:.|:::...:||      :....|:...|  ::..||:|.||.||||.|.| 
 Frog    10 MSREVQSRIEKKYDEELEQRLVQWICIQCGDDVGTPEQGRLG--FQQWLKNGLVLSKLINSLYP- 71

  Fly    62 AVPKVNSSGGQ------------FKFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNT 114
                   .|.|            ||.||.:..|.:|.::|||...|:||||||||.||:|.|..|
 Frog    72 -------KGSQPVKIPDPPPSMVFKQMEQVAQFLRASEDYGVVKTDMFQTVDLYEGKDMAAVQRT 129

  Fly   115 IFALG--RATYKHADFKG-PFLGPKPADECKRDFTEEQLKAGQTIVGLQAGSNKGATQAGQNLGA 176
            |.|||  ..|.....:|| |....|.|.|.||||::|:||.|:.|:|||.|||:||||:|.. |.
 Frog   130 IVALGSIAVTKNDGQYKGDPSWFMKKAQEHKRDFSDEKLKEGKNIIGLQMGSNQGATQSGMT-GY 193

  Fly   177 GR 178
            ||
 Frog   194 GR 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mp20NP_001014522.2 SCP1 7..179 CDD:227526 78/193 (40%)
CH 18..121 CDD:237981 45/122 (37%)
Calponin 158..178 CDD:278814 12/19 (63%)
taglnNP_001025579.1 SCP1 14..189 CDD:227526 74/184 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I8493
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - otm47470
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 1 1.000 - - X194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.040

Return to query results.
Submit another query.