DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp20 and cnn1b

DIOPT Version :9

Sequence 1:NP_001014522.2 Gene:Mp20 / 36468 FlyBaseID:FBgn0002789 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_701038.5 Gene:cnn1b / 572250 ZFINID:ZDB-GENE-091118-54 Length:296 Species:Danio rerio


Alignment Length:182 Identity:68/182 - (37%)
Similarity:111/182 - (60%) Gaps:8/182 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LERAVRAKIASKRNPEMDKEAQEWIEAIIAEKFPAGQSYEDVLKDGQVLCKLINVLSPNAVPKVN 67
            |...|::|:|.|.:|:.::|.:.||..:...|.|  :::.:.||||.:||:|||.|.|.:|.|:|
Zfish    13 LSAEVKSKLAHKYDPQKEEELRMWISDVTGRKLP--ENFMEGLKDGVLLCELINTLQPGSVRKIN 75

  Fly    68 SSGGQFKFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFAL-GRATYK--HADFK 129
            :|...:..:|||.||.:|::|||:...::|:..||:|..:...|.:|:.|| |.|..|  |:.:.
Zfish    76 NSPQNWHQLENIGNFVRAIQEYGLKPHEIFEANDLFENVNHTQVQSTLIALAGMAKSKGFHSKYD 140

  Fly   130 GPFLGPKPADECKRDFTEEQLKAGQTIVGLQAGSNKGATQAGQNLGAGRKIL 181
               :|.|.|::.:|.|..|:||.|:.|:|||.|:||.|:|.|......|:.|
Zfish   141 ---IGVKYAEKQQRRFAPEKLKEGRNIIGLQMGTNKFASQKGMTSYGTRRHL 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mp20NP_001014522.2 SCP1 7..179 CDD:227526 65/174 (37%)
CH 18..121 CDD:237981 38/103 (37%)
Calponin 158..178 CDD:278814 9/19 (47%)
cnn1bXP_701038.5 SCP1 17..179 CDD:227526 64/166 (39%)
CH 30..126 CDD:278723 35/97 (36%)
Calponin 165..188 CDD:278814 10/22 (45%)
Calponin 205..228 CDD:278814
Calponin 245..267 CDD:278814
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578017
Domainoid 1 1.000 83 1.000 Domainoid score I8268
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X194
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.