DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp20 and cnn1a

DIOPT Version :9

Sequence 1:NP_001014522.2 Gene:Mp20 / 36468 FlyBaseID:FBgn0002789 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001139070.1 Gene:cnn1a / 567396 ZFINID:ZDB-GENE-090312-141 Length:287 Species:Danio rerio


Alignment Length:193 Identity:69/193 - (35%)
Similarity:108/193 - (55%) Gaps:21/193 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LERAVRAKIASKRNPEMDKEAQEWIEAI----IAEKFPAGQSYEDVLKDGQVLCKLINVLSPNAV 63
            |...||.|:|.|.:|:.:::.:.|::.|    :||.|..|      ||||.:||:|||.|.|.:|
Zfish    13 LSADVRNKLAQKYDPQTEEDLRMWVQEITGRTLAENFMEG------LKDGVILCELINKLQPGSV 71

  Fly    64 PKVNSSGGQFKFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFALG-----RATY 123
            ||||.|...:..:|||.:|.:|:.|||:...|:|:..||:|..:...|..|:.||.     :..|
Zfish    72 PKVNHSTLNWHKLENITHFVRAIGEYGLKPHDIFEANDLFEDMNHTQVQCTLVALAGLAKTKGFY 136

  Fly   124 KHADFKGPFLGPKPADECKRDFTEEQLKAGQTIVGLQAGSNKGATQAGQ-NLGAGRKILLGKV 185
            ..:|     :|.|.|.:.:|.|..:::|||::|:..|.||||.|:|.|. :.|..|.:...|:
Zfish   137 TKSD-----IGVKYAAKKQRKFNPDKMKAGKSIISQQMGSNKFASQKGMTSYGTRRHLYEPKI 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mp20NP_001014522.2 SCP1 7..179 CDD:227526 66/181 (36%)
CH 18..121 CDD:237981 40/111 (36%)
Calponin 158..178 CDD:278814 9/20 (45%)
cnn1aNP_001139070.1 SCP1 16..179 CDD:227526 64/173 (37%)
CH 30..126 CDD:278723 38/101 (38%)
Calponin 165..188 CDD:278814 9/22 (41%)
Calponin 205..228 CDD:278814
Calponin 245..266 CDD:278814
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578016
Domainoid 1 1.000 83 1.000 Domainoid score I8268
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.