DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp20 and tagln3a

DIOPT Version :9

Sequence 1:NP_001014522.2 Gene:Mp20 / 36468 FlyBaseID:FBgn0002789 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001096584.1 Gene:tagln3a / 563096 ZFINID:ZDB-GENE-060531-53 Length:213 Species:Danio rerio


Alignment Length:190 Identity:71/190 - (37%)
Similarity:107/190 - (56%) Gaps:11/190 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LERAVRAKIASKRNPEMDKEAQEWIEAIIAEKF----PAGQSYEDVLKDGQVLCKLINVLSPNA- 62
            |.|.|:.||..|.:.|::....:||.....:..    |..|:::..|..|.:||:|||.|.|:. 
Zfish    10 LSREVQEKIDQKYDAELESRLVDWILIQCGDDLQRPEPGKQNFQKWLMSGTILCRLINSLYPSGE 74

  Fly    63 --VPKVNSSGGQFKFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFALGRATYKH 125
              :.|:..|...||.||.|:.|.:..:||||...|:||||||:|.||:|.|..|:.|||......
Zfish    75 EPIKKITESKMVFKQMEKISQFLQFAEEYGVNRGDIFQTVDLWEGKDMAAVQRTLMALGSEALTK 139

  Fly   126 AD--FKG-PFLGPKPADECKRDFTEEQLKAGQTIVGLQAGSNKGATQAGQ-NLGAGRKIL 181
            .|  ::| |....:.....||:|:||||:.|:.::|:|.|||:||:|:|. ..|..|:|:
Zfish   140 DDGHYRGDPDWFHRKTKGHKREFSEEQLRQGRVVIGMQMGSNRGASQSGMVGYGTPRQIM 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mp20NP_001014522.2 SCP1 7..179 CDD:227526 67/182 (37%)
CH 18..121 CDD:237981 42/109 (39%)
Calponin 158..178 CDD:278814 10/20 (50%)
tagln3aNP_001096584.1 SCP1 14..188 CDD:227526 65/173 (38%)
CH 25..132 CDD:278723 39/106 (37%)
Calponin 174..197 CDD:278814 10/22 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578020
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I4556
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - mtm6375
orthoMCL 1 0.900 - - OOG6_102866
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X194
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.700

Return to query results.
Submit another query.