DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp20 and iqgap2

DIOPT Version :9

Sequence 1:NP_001014522.2 Gene:Mp20 / 36468 FlyBaseID:FBgn0002789 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001121812.1 Gene:iqgap2 / 563030 ZFINID:ZDB-GENE-030131-2878 Length:1680 Species:Danio rerio


Alignment Length:143 Identity:42/143 - (29%)
Similarity:69/143 - (48%) Gaps:21/143 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KEAQEWIEAIIAEKFPAGQSYEDVLKDGQVLCKLINVLSPNAVPK----------VNSSGGQFKF 75
            :||::|:||.:.|:.|.....|:.|::|..|.||....:|..|.:          ...||..|:.
Zfish    57 EEAKQWMEACLEEQLPPTTELENGLRNGVYLGKLAKFFAPQLVSEKKIYDRDQSWYKLSGLHFRH 121

  Fly    76 MENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFALGRATYKHADFKGPFLGPKPADE 140
            .:|...:.:|::..|:|.|...:|.|:|::|::..|...|.||....||        ||..|..:
Zfish   122 TDNTVQWLRAMESIGLPKIFYPETTDVYDRKNMPKVIYCIHALSLYLYK--------LGIAPQIQ 178

  Fly   141 ---CKRDFTEEQL 150
               .|.|||||::
Zfish   179 DLLGKVDFTEEEI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mp20NP_001014522.2 SCP1 7..179 CDD:227526 42/143 (29%)
CH 18..121 CDD:237981 31/109 (28%)
Calponin 158..178 CDD:278814
iqgap2NP_001121812.1 CH 54..169 CDD:237981 31/111 (28%)
RasGAP 1001..1354 CDD:214617
RasGAP_IQGAP2 1012..1370 CDD:213333
RasGAP_C 1463..1602 CDD:281787
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.