DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp20 and Cnn3

DIOPT Version :9

Sequence 1:NP_001014522.2 Gene:Mp20 / 36468 FlyBaseID:FBgn0002789 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_038958917.1 Gene:Cnn3 / 54321 RGDID:71044 Length:374 Species:Rattus norvegicus


Alignment Length:179 Identity:71/179 - (39%)
Similarity:105/179 - (58%) Gaps:8/179 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AVRAKIASKRNPEMDKEAQEWIEAIIAEKFPAGQSYEDVLKDGQVLCKLINVLSPNAVPKVNSSG 70
            ||...||||.:.:.:::.:.|||.:..  ...|.:::..||||.:||:|||.|.|.:|.|||.|.
  Rat    59 AVPPPIASKYDQQAEEDLRNWIEEVTG--MGIGTNFQLGLKDGIILCELINKLQPGSVKKVNESS 121

  Fly    71 GQFKFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFAL-GRATYK--HADFKGPF 132
            ..:..:|||.||.||::.||:...|:|:..||:|..::..|..|:.|| |.|..|  |....   
  Rat   122 LNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTID--- 183

  Fly   133 LGPKPADECKRDFTEEQLKAGQTIVGLQAGSNKGATQAGQNLGAGRKIL 181
            :|.|.|::..|.|.|.:|||||:::|||.|:||.|:|||......|:.|
  Rat   184 IGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mp20NP_001014522.2 SCP1 7..179 CDD:227526 68/174 (39%)
CH 18..121 CDD:237981 39/103 (38%)
Calponin 158..178 CDD:278814 10/19 (53%)
Cnn3XP_038958917.1 CH_CNN3 67..177 CDD:409133 41/111 (37%)
Calponin 208..232 CDD:395325 11/23 (48%)
Calponin 248..272 CDD:395325
Calponin 287..311 CDD:395325
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I7649
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - mtm8915
orthoMCL 1 0.900 - - OOG6_102866
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.720

Return to query results.
Submit another query.