DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp20 and CG5023

DIOPT Version :9

Sequence 1:NP_001014522.2 Gene:Mp20 / 36468 FlyBaseID:FBgn0002789 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_650867.1 Gene:CG5023 / 42400 FlyBaseID:FBgn0038774 Length:169 Species:Drosophila melanogaster


Alignment Length:163 Identity:86/163 - (52%)
Similarity:116/163 - (71%) Gaps:2/163 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 RNPEMDKEAQEWIEAIIAEKFPAGQSYEDVLKDGQVLCKLINVLSPNAVPKVNSSGGQFKFMENI 79
            ||.|.::|...|:.|:|.||.|:|| |||:||||..||||.|.|:|.:|.|:...|..|:.||||
  Fly     4 RNKEQEQEVLNWVFAVIGEKVPSGQ-YEDILKDGIWLCKLANKLAPGSVKKIQERGTNFQLMENI 67

  Fly    80 NNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFALGRATYKHADFKGPFLGPKPADECKRD 144
            ..||.|:|:||||:.::|||.||:|:::|..||.:::||||.|.||.::.||.||||.||:.:|.
  Fly    68 QRFQAAVKKYGVPEEEIFQTADLFERRNIPQVTLSLYALGRITQKHPEYTGPTLGPKMADKNERS 132

  Fly   145 FTEEQLKAGQTIVGLQAGSNKGATQAGQNLGAG 177
            ||||||:|.:..:.||.|.||||:|||.. |.|
  Fly   133 FTEEQLRAHEGELNLQMGFNKGASQAGHG-GMG 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mp20NP_001014522.2 SCP1 7..179 CDD:227526 86/163 (53%)
CH 18..121 CDD:237981 52/102 (51%)
Calponin 158..178 CDD:278814 12/20 (60%)
CG5023NP_650867.1 CH_dMP20-like 4..108 CDD:409056 53/104 (51%)
Calponin 145..168 CDD:395325 12/21 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I4320
eggNOG 1 0.900 - - E1_COG5199
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I4556
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D121012at6656
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - mtm6375
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 1 1.000 - - X194
98.900

Return to query results.
Submit another query.