DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp20 and cnn2

DIOPT Version :9

Sequence 1:NP_001014522.2 Gene:Mp20 / 36468 FlyBaseID:FBgn0002789 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_998841.1 Gene:cnn2 / 407907 XenbaseID:XB-GENE-1005289 Length:295 Species:Xenopus tropicalis


Alignment Length:184 Identity:63/184 - (34%)
Similarity:104/184 - (56%) Gaps:12/184 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LERAVRAKIASKRNPEMDKEAQEWIEAIIAEKFPAGQSYEDVLKDGQVLCKLINVLSPNAVPKVN 67
            |...||.|:|.|.:|:.:.|.:.|||.:..  ...|..::..||||.:||:|:|.|.|:::||||
 Frog    13 LSAEVRNKLAQKYDPQKETELKVWIEEVTG--MSIGPDFQKGLKDGVILCELMNKLRPHSIPKVN 75

  Fly    68 SSGGQFKFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFAL-----GRATYKHAD 127
            .|...:..:||::||.||:..||:..:|:|:..||:|..::..|..::.||     .|......|
 Frog    76 VSRQNWHQLENLSNFIKAMNLYGMKSVDLFEANDLFENGNMTQVQVSLLALAGLAKSRGMQSEVD 140

  Fly   128 FKGPFLGPKPADECKRDFTEEQLKAGQTIVGLQAGSNKGATQAGQNLGAGRKIL 181
                 :|.|.:::.:|:|.:...|||..::|||.|:||.|:|:|......|:.|
 Frog   141 -----IGVKYSEKQERNFDDNTKKAGHCVIGLQMGTNKCASQSGMTAYGTRRHL 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mp20NP_001014522.2 SCP1 7..179 CDD:227526 60/176 (34%)
CH 18..121 CDD:237981 36/107 (34%)
Calponin 158..178 CDD:278814 9/19 (47%)
cnn2NP_998841.1 SCP1 17..189 CDD:227526 61/178 (34%)
Calponin 205..228 CDD:366078
Calponin 244..266 CDD:366078
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H3215
Inparanoid 1 1.050 115 1.000 Inparanoid score I4677
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - otm47470
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.