DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp20 and Iqgap3

DIOPT Version :9

Sequence 1:NP_001014522.2 Gene:Mp20 / 36468 FlyBaseID:FBgn0002789 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001028656.1 Gene:Iqgap3 / 404710 MGIID:3028642 Length:1632 Species:Mus musculus


Alignment Length:179 Identity:51/179 - (28%)
Similarity:81/179 - (45%) Gaps:46/179 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AVRAKIASKR--NPEMD---------------KEAQEWIEAIIAEKFPAGQSYEDVLKDGQVLCK 53
            |.||:.|.:|  ..|||               :||:.|:|..:.|:.|:....|:.|::|.:|.|
Mouse     6 AGRARTAYERLTAEEMDEQRRQNVAYQYLCRLEEAKRWMEVCLKEELPSPVELEESLRNGVLLAK 70

  Fly    54 LINVLSPNAVP----------KVNSSGGQFKFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDI 108
            |.:..:|:.||          :..::|..|:..:|||.:..|:...|:|.|.:.:|.|:|:||::
Mouse    71 LGHCFAPSVVPLKKIYDVEQLRYQATGLHFRHTDNINFWLSAVAHIGLPSIFLPETTDIYDKKNM 135

  Fly   109 ANVTNTI-------FALGRATYKHADFKGPFLGPKPADECKRDFTEEQL 150
            ..|...|       |.||.|...| |..|           |..||.|:|
Mouse   136 PRVIYCIHALSLFLFRLGLAPQIH-DLYG-----------KVKFTAEEL 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mp20NP_001014522.2 SCP1 7..179 CDD:227526 50/178 (28%)
CH 18..121 CDD:237981 37/134 (28%)
Calponin 158..178 CDD:278814
Iqgap3NP_001028656.1 CH 35..147 CDD:237981 31/111 (28%)
IQ 764..782 CDD:197470
RasGAP 977..1328 CDD:214617
RasGAP 988..1337 CDD:295371
RasGAP_C 1434..1555 CDD:281787
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.