DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp20 and cnn3

DIOPT Version :9

Sequence 1:NP_001014522.2 Gene:Mp20 / 36468 FlyBaseID:FBgn0002789 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_989257.1 Gene:cnn3 / 394869 XenbaseID:XB-GENE-951266 Length:331 Species:Xenopus tropicalis


Alignment Length:188 Identity:69/188 - (36%)
Similarity:109/188 - (57%) Gaps:20/188 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LERAVRAKIASKRNPEMDKEAQEWIE----AIIAEKFPAGQSYEDVLKDGQVLCKLINVLSPNAV 63
            |...|:.|||.|.:|::::|.:.|||    .||.|.|..|      |:||.:||.|||.|.|.::
 Frog    12 LSAEVKNKIAQKYDPQVEEELRLWIEEVTGMIIGENFQQG------LRDGIILCNLINKLQPGSI 70

  Fly    64 PKVNSSGGQFKFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFALG-----RATY 123
            .|:|.:...:..:|||.||.||:::||:...|:|:..||:|..::..|..::.:|.     |..:
 Frog    71 KKINEAKLNWHKLENIGNFIKAMQDYGMKPHDIFEANDLFENGNMTQVQTSLVSLAGLAKTRGFH 135

  Fly   124 KHADFKGPFLGPKPADECKRDFTEEQLKAGQTIVGLQAGSNKGATQAGQNLGAGRKIL 181
            ...|     :|.|.|::.||.|.:|::||||:::|||.|:||.|:|||......|:.|
 Frog   136 TSVD-----IGVKYAEKQKRQFGDEKMKAGQSVIGLQMGTNKCASQAGMTAYGTRRHL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mp20NP_001014522.2 SCP1 7..179 CDD:227526 66/180 (37%)
CH 18..121 CDD:237981 37/111 (33%)
Calponin 158..178 CDD:278814 10/19 (53%)
cnn3NP_989257.1 CH 27..126 CDD:366016 36/104 (35%)
Calponin 164..187 CDD:366078 11/22 (50%)
Calponin 204..226 CDD:366078
Calponin 243..266 CDD:366078
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I4677
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - otm47470
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 1 1.000 - - X194
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.