DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp20 and cnn3a

DIOPT Version :9

Sequence 1:NP_001014522.2 Gene:Mp20 / 36468 FlyBaseID:FBgn0002789 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_956047.1 Gene:cnn3a / 326931 ZFINID:ZDB-GENE-030131-5130 Length:329 Species:Danio rerio


Alignment Length:183 Identity:69/183 - (37%)
Similarity:106/183 - (57%) Gaps:10/183 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LERAVRAKIASKRNPEMDKEAQEWIEAIIAEKFPAGQSYEDVLKDGQVLCKLINVLSPNAVPKVN 67
            |...|:.|||.|.:.:.::|.:.|||.:..  .|.|..::..||||.:||:|||.|.|.::.|:|
Zfish    12 LSAEVKNKIAQKYDLQKEEELRFWIEEVTG--MPIGDHFQKGLKDGVILCELINKLQPGSIKKIN 74

  Fly    68 SSGGQFKFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFALGRATYKHADFKGP- 131
            .|...:..:||:.||.||:..||:...|:|:..||:|..::..|..|:.||.    ..|..||. 
Zfish    75 HSQLNWHKLENLGNFIKAILAYGLKPNDIFEANDLFENGNMTQVQTTLLALA----SMAKTKGME 135

  Fly   132 ---FLGPKPADECKRDFTEEQLKAGQTIVGLQAGSNKGATQAGQNLGAGRKIL 181
               .:|.|.||:.:|:|.:|::||||.::|||.|:||.|:|||......|:.|
Zfish   136 TNIDIGVKYADKQQRNFDDEKMKAGQCVIGLQMGTNKCASQAGMTAYGTRRHL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mp20NP_001014522.2 SCP1 7..179 CDD:227526 66/175 (38%)
CH 18..121 CDD:237981 37/102 (36%)
Calponin 158..178 CDD:278814 10/19 (53%)
cnn3aNP_956047.1 SCP1 27..188 CDD:227526 62/166 (37%)
CH 29..125 CDD:278723 35/97 (36%)
Calponin 164..187 CDD:278814 11/22 (50%)
Calponin 204..226 CDD:278814
Calponin 243..266 CDD:278814
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8268
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - mtm6375
orthoMCL 1 0.900 - - OOG6_102866
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 1 1.000 - - X194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.