DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp20 and TAGLN3

DIOPT Version :9

Sequence 1:NP_001014522.2 Gene:Mp20 / 36468 FlyBaseID:FBgn0002789 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001008273.1 Gene:TAGLN3 / 29114 HGNCID:29868 Length:199 Species:Homo sapiens


Alignment Length:190 Identity:81/190 - (42%)
Similarity:113/190 - (59%) Gaps:11/190 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LERAVRAKIASKRNPEMDKEAQEWIEAIIAEKF---PAGQS-YEDVLKDGQVLCKLINVLSP--- 60
            |.|.|:.||..|.:.:::.:..:||....||..   |.|:: ::..|.||.|||||||.|.|   
Human    10 LSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLYPPGQ 74

  Fly    61 NAVPKVNSSGGQFKFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFALGRATYKH 125
            ..:||::.|...||.||.|:.|.||.:.|||...|:||||||:|.||:|.|..|:.|||......
Human    75 EPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTK 139

  Fly   126 AD--FKG-PFLGPKPADECKRDFTEEQLKAGQTIVGLQAGSNKGATQAGQ-NLGAGRKIL 181
            .|  ::| |....:.|.:.:|.|:||||:.||.::|||.||||||:|||. ..|..|:|:
Human   140 DDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIM 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mp20NP_001014522.2 SCP1 7..179 CDD:227526 77/182 (42%)
CH 18..121 CDD:237981 48/109 (44%)
Calponin 158..178 CDD:278814 13/20 (65%)
TAGLN3NP_001008273.1 CH_TAGLN3 23..141 CDD:409130 48/117 (41%)
Calponin-like 174..199 14/24 (58%)
Calponin 174..198 CDD:395325 14/23 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..199 13/22 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144835
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - mtm8439
orthoMCL 1 0.900 - - OOG6_102866
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 1 1.000 - - X194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.680

Return to query results.
Submit another query.