DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp20 and rng2

DIOPT Version :9

Sequence 1:NP_001014522.2 Gene:Mp20 / 36468 FlyBaseID:FBgn0002789 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_593860.1 Gene:rng2 / 2543129 PomBaseID:SPAC4F8.13c Length:1489 Species:Schizosaccharomyces pombe


Alignment Length:152 Identity:42/152 - (27%)
Similarity:73/152 - (48%) Gaps:18/152 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KIASKRNPEMD--------KEAQEWIEAIIAEKFPAGQSYEDVLKDGQVLCKLINVLSPNAVPKV 66
            ::|:|:...:.        .||::|||..:........::|..|::|.||..|:....|:.:.|:
pombe    26 RLAAKQRETLQAYDYLCRVDEAKKWIEECLGTDLGPTSTFEQSLRNGVVLALLVQKFQPDKLIKI 90

  Fly    67 -NSSGGQFKFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFALGRATY--KHADF 128
             .|:..||:..:|||.|...:...|:|:|..|:..|:||.|::..|...|.||   :|  ...|.
pombe    91 FYSNELQFRHSDNINKFLDFIHGIGLPEIFHFELTDIYEGKNLPKVIYCIHAL---SYFLSMQDL 152

  Fly   129 KGPFLGPKPADECKRDFTEEQL 150
            ..|.:   .:|| ...||:|.:
pombe   153 APPLI---KSDE-NLSFTDEDV 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mp20NP_001014522.2 SCP1 7..179 CDD:227526 42/152 (28%)
CH 18..121 CDD:237981 32/111 (29%)
Calponin 158..178 CDD:278814
rng2NP_593860.1 IQG1 1..1489 CDD:227586 42/152 (28%)
CH 42..145 CDD:237981 32/105 (30%)
RasGAP_IQGAP_related 846..1217 CDD:213345
RasGAP_C 1274..1410 CDD:281787
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I3105
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.