DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp20 and Tagln

DIOPT Version :9

Sequence 1:NP_001014522.2 Gene:Mp20 / 36468 FlyBaseID:FBgn0002789 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_113737.1 Gene:Tagln / 25123 RGDID:3723 Length:201 Species:Rattus norvegicus


Alignment Length:191 Identity:76/191 - (39%)
Similarity:109/191 - (57%) Gaps:20/191 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LERAVRAKIASKRNPEMDKEAQEWIEAIIAEKFP-AGQ------SYEDVLKDGQVLCKLINVLSP 60
            :.|.|::||..|.:.|:::...||   |:.:..| .|:      .::..||:|.:|.||:|.|.|
  Rat    10 MSREVQSKIEKKYDEELEERLVEW---IVMQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYP 71

  Fly    61 NA-----VPKVNSSGGQFKFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFALG- 119
            ..     ||: |.....||.||.:..|.||.::|||...|:||||||:|.||:|.|..|:.||| 
  Rat    72 EGSKPVKVPE-NPPSMVFKQMEQVAQFLKAAEDYGVTKTDMFQTVDLFEGKDMAAVQRTVMALGS 135

  Fly   120 -RATYKHADFKG-PFLGPKPADECKRDFTEEQLKAGQTIVGLQAGSNKGATQAGQNLGAGR 178
             ..|.....::| |....|.|.|.||:||:.||:.|:.::|||.|||:||:|||.. |.||
  Rat   136 LAVTKNDGHYRGDPNWFMKKAQEHKREFTDSQLQEGKHVIGLQMGSNRGASQAGMT-GYGR 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mp20NP_001014522.2 SCP1 7..179 CDD:227526 75/187 (40%)
CH 18..121 CDD:237981 44/116 (38%)
Calponin 158..178 CDD:278814 12/19 (63%)
TaglnNP_113737.1 CH_TAGLN 23..143 CDD:409128 45/123 (37%)
Could be involved in actin-binding 154..161 3/6 (50%)
Calponin-like 175..200 14/22 (64%)
Calponin 175..199 CDD:395325 14/22 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338526
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - mtm8915
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.