DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp20 and Tagln

DIOPT Version :9

Sequence 1:NP_001014522.2 Gene:Mp20 / 36468 FlyBaseID:FBgn0002789 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_035656.1 Gene:Tagln / 21345 MGIID:106012 Length:201 Species:Mus musculus


Alignment Length:191 Identity:78/191 - (40%)
Similarity:110/191 - (57%) Gaps:20/191 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LERAVRAKIASKRNPEMDKEAQEWIEAIIAEKFP-AGQ------SYEDVLKDGQVLCKLINVLSP 60
            :.|.|::||..|.:.|:::...||   |:.:..| .|:      .::..||:|.:|.||:|.|.|
Mouse    10 MSREVQSKIEKKYDEELEERLVEW---IVVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYP 71

  Fly    61 NA-----VPKVNSSGGQFKFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFALG- 119
            ..     ||: |.....||.||.:..|.||.::|||...|:||||||||.||:|.|..|:.||| 
Mouse    72 EGSKPVKVPE-NPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLYEGKDMAAVQRTLMALGS 135

  Fly   120 -RATYKHADFKG-PFLGPKPADECKRDFTEEQLKAGQTIVGLQAGSNKGATQAGQNLGAGR 178
             ..|....:::| |....|.|.|.|||||:.||:.|:.::|||.|||:||:|||.. |.||
Mouse   136 LAVTKNDGNYRGDPNWFMKKAQEHKRDFTDSQLQEGKHVIGLQMGSNRGASQAGMT-GYGR 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mp20NP_001014522.2 SCP1 7..179 CDD:227526 77/187 (41%)
CH 18..121 CDD:237981 45/116 (39%)
Calponin 158..178 CDD:278814 12/19 (63%)
TaglnNP_035656.1 SCP1 14..189 CDD:227526 72/178 (40%)
CH 25..137 CDD:237981 45/115 (39%)
Calponin-like 175..200 14/22 (64%)
Calponin 175..198 CDD:278814 14/22 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834941
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2163
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 1 1.000 - - mtm8680
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 1 1.000 - - X194
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.730

Return to query results.
Submit another query.