DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Mp20 and clik-3

DIOPT Version :9

Sequence 1:	NP_001014522.2	Gene:	Mp20 / 36468	FlyBaseID:	FBgn0002789	Length:	189	Species:	Drosophila melanogaster
Sequence 2:	NP_001021535.1	Gene:	clik-3 / 186951	WormBaseID:	WBGene00019361	Length:	202	Species:	Caenorhabditis elegans

Alignment Length:	143	Identity:	32/143 - (22%)
Similarity:	52/143 - (36%)	Gaps:	45/143 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly    30 IIAEKFPAGQSYEDVLKDGQVLCKLINVLSPNAVPKVNSSGGQFKFMENINNFQKALKEYGVPDI 94
            |.|.:.|:.:..|...:||:  ..|..:...:|:..:.|...||       :.|:....:|:|
Worm    16 IAAVEVPSNEQLERRTRDGK--WTLRQLRQTDAMVPLQSGTNQF-------DSQRGKTGFGMP-- 69

  Fly    95 DVFQTVDLYEKKDIANVTNTIFALGRATYKHADFKGPFLGPKPADECKRDFTEEQLKAGQTIVGL 159
                                     |.|....||         ||..|:...|||.:....||.|
Worm    70 -------------------------RNTQTKVDF---------ADHDKQWLIEEQKQYSDAIVRL 100

  Fly   160 QAGSNKGATQAGQ 172
            |:|:|:..:|.|:
Worm   101 QSGTNQFESQKGK 113

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Mp20	NP_001014522.2	SCP1	7..179	CDD:227526	32/143 (22%)
		CH	18..121	CDD:237981	14/90 (16%)
		Calponin	158..178	CDD:278814	6/15 (40%)
clik-3	NP_001021535.1	DinB_2	<17..>41	CDD:304397	6/25 (24%)
		Calponin	50..70	CDD:278814	6/53 (11%)
		Calponin	99..120	CDD:278814	6/15 (40%)
		Calponin	148..169	CDD:278814
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D861989at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.920