DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp20 and cpn-1

DIOPT Version :9

Sequence 1:NP_001014522.2 Gene:Mp20 / 36468 FlyBaseID:FBgn0002789 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001369984.1 Gene:cpn-1 / 172660 WormBaseID:WBGene00000777 Length:192 Species:Caenorhabditis elegans


Alignment Length:181 Identity:74/181 - (40%)
Similarity:108/181 - (59%) Gaps:8/181 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLERAVRAKIASKRNPEMDKEAQEWIEAIIAEKFPAGQSYEDVLK---DGQVLCKLINVLSPNA 62
            ::||  .:.||..|.:..:..|..:|::.:..:.|......::::|   ||.:||.|.|.|.|.:
 Worm    15 IALE--AQQKIYEKYDKNLAGEILQWVQNVTGQSFDTQGDADNLVKVFQDGSLLCTLANSLKPGS 77

  Fly    63 VPKVNSSGGQFKFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFALGRATYKHAD 127
            |.|||:|...||.||||:.|.|..:|| |...::||||||||.:|...|...:.:|.|.:.|:..
 Worm    78 VKKVNTSAMAFKKMENISFFLKFAEEY-VQKSELFQTVDLYEGQDPNAVLICLASLARKSEKNFG 141

  Fly   128 FKGPFLGPKPADECKRDFTEEQLKAGQTIVGLQAGSNKGATQAGQNLGAGR 178
            ..|  ||||.|...:|::|:||||||..::|||.|||||||.:|.|:|..|
 Worm   142 RSG--LGPKEAQGDRREWTDEQLKAGHNVIGLQMGSNKGATASGLNMGNTR 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mp20NP_001014522.2 SCP1 7..179 CDD:227526 72/175 (41%)
CH 18..121 CDD:237981 39/105 (37%)
Calponin 158..178 CDD:278814 13/19 (68%)
cpn-1NP_001369984.1 CH_dMP20-like 26..134 CDD:409056 40/108 (37%)
Calponin 169..191 CDD:395325 14/22 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56098
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102866
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 1 1.000 - - X194
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.760

Return to query results.
Submit another query.