DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp20 and cpn-3

DIOPT Version :9

Sequence 1:NP_001014522.2 Gene:Mp20 / 36468 FlyBaseID:FBgn0002789 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_491282.1 Gene:cpn-3 / 171986 WormBaseID:WBGene00000779 Length:142 Species:Caenorhabditis elegans


Alignment Length:133 Identity:50/133 - (37%)
Similarity:72/133 - (54%) Gaps:10/133 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AVRAKIASKRNPEMDKEAQ---EWIEAIIAEKFPAG---QSYEDVLKDGQVLCKLINVLSPNAVP 64
            |||.|..||   .:||||.   |||:.:..|.....   .::.::||||.:|||..|.:...::.
 Worm    13 AVRQKQDSK---FIDKEATLLLEWIKKLSGENISTSGERDNFHNLLKDGTLLCKAANGIEAGSIK 74

  Fly    65 KVNSSGGQFKFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFALGRATYKHADFK 129
            ||......|..|||||.|.:..|:.|||:.:.||:|:|.|.:|:.:|..|:.:|||...| |...
 Worm    75 KVQKPISTFACMENINAFVEFAKKQGVPNEETFQSVELVEGRDLFSVCVTLLSLGRVLQK-AGKT 138

  Fly   130 GPF 132
            .||
 Worm   139 NPF 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mp20NP_001014522.2 SCP1 7..179 CDD:227526 49/132 (37%)
CH 18..121 CDD:237981 39/108 (36%)
Calponin 158..178 CDD:278814
cpn-3NP_491282.1 CH 30..133 CDD:237981 36/102 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158392
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D488325at33208
OrthoFinder 1 1.000 - - FOG0000270
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.780

Return to query results.
Submit another query.