DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mp20 and IQGAP3

DIOPT Version :9

Sequence 1:NP_001014522.2 Gene:Mp20 / 36468 FlyBaseID:FBgn0002789 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_024309041.1 Gene:IQGAP3 / 128239 HGNCID:20669 Length:1643 Species:Homo sapiens


Alignment Length:190 Identity:53/190 - (27%)
Similarity:84/190 - (44%) Gaps:46/190 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KEAQEWIEAIIAEKFPAGQSYEDVLKDGQVLCKLINVLSPNAVP----------KVNSSGGQFKF 75
            :||:.|:||.:.|:.|:....|:.|::|.:|.||.:..:|:.||          :..::|..|:.
Human    43 EEAKRWMEACLKEELPSPVELEESLRNGVLLAKLGHCFAPSVVPLKKIYDVEQLRYQATGLHFRH 107

  Fly    76 MENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTI-------FALGRATYKHADFKGPFL 133
            .:|||.:..|:...|:|.....:|.|:|:||::..|...|       |.||.|...| |..|   
Human   108 TDNINFWLSAIAHIGLPSTFFPETTDIYDKKNMPRVVYCIHALSLFLFRLGLAPQIH-DLYG--- 168

  Fly   134 GPKPADECKRDFTEEQLKAGQTIVGLQAGSNKGATQA--GQNLGAGRK---ILLGKVIID 188
                    |..||.|:|            ||..:..|  |..|.|..|   ||..::.:|
Human   169 --------KVKFTAEEL------------SNMASELAKYGLQLPAFSKIGGILANELSVD 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mp20NP_001014522.2 SCP1 7..179 CDD:227526 49/176 (28%)
CH 18..121 CDD:237981 34/116 (29%)
Calponin 158..178 CDD:278814 6/21 (29%)
IQGAP3XP_024309041.1 RasGAP_C 16..>209 CDD:332048 53/190 (28%)
Myosin_head <746..>969 CDD:332202
RasGAP_C <873..1643 CDD:332048
RasGAP_IQGAP3 999..1348 CDD:213346
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2278
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.